Roseobase: Octadecabacter antarcticus str. 307

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: OAN307:300000..400000, OAN307_63p00080, trnR1, transcriptional regulator, TLEDLRVQAVGKKGEVSLQMRSLGKMTPEERQTAGPALNA.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 1725 regions match your request.
Search results are limited to 1000 hits; list may be incomplete.
Matches on OAN307
overview_OAN307
coaBC coenzyme A biosynthesis phosphopantothenoylcysteine decarboxylase/phosphopantothenoylcysteine synthase-fusion protein OAN307:3.829..3.83 Mbp (1.188 kbp) score=30
OAN307_c07490 hypothetical protein containing AMP-dependent synthetase/ligase domain OAN307:722..722.6 kbp (531 bp) score=20
OAN307_c09300 'alternative name(s): CMP-N-acetylneuraminic acid synthetase; CMP-NeuAc synthetase' OAN307:911.6..912.3 kbp (699 bp) score=20
OAN307_c15980 hypothetical protein associated with PHB synthesis OAN307:1.586..1.587 Mbp (483 bp) score=20
OAN307_c21670 hypothetical protein associated with cytochrome biosynthesis gene cluster and secFD gene cluster OAN307:2.166..2.167 Mbp (354 bp) score=20
OAN307_c29520 putative hypothetical protein associated with flagellum synthesis OAN307:2.944..2.944 Mbp (282 bp) score=20
OAN307_c29570 putative hypothetical protein associated with flagellum synthesis OAN307:2.948..2.949 Mbp (405 bp) score=20
OAN307_c30340 hypothetical protein associated with gas-vesicle synthesis OAN307:3.025..3.026 Mbp (783 bp) score=20
OAN307_c00060 hypothetical protein OAN307:7.779..8.096 kbp (318 bp) score=10
OAN307_c00090 hypothetical protein OAN307:9.831..9.977 kbp (147 bp) score=10
OAN307_c00120 hypothetical protein OAN307:12.38..12.57 kbp (189 bp) score=10
OAN307_c00270 hypothetical protein OAN307:29.95..30.23 kbp (285 bp) score=10
OAN307_c00290 hypothetical protein; IS4-family transposase(fragment)-like OAN307:31.18..31.76 kbp (582 bp) score=10
OAN307_c00300 hypothetical protein OAN307:31.86..32.73 kbp (870 bp) score=10
OAN307_c00400 hypothetical protein OAN307:43.78..44.16 kbp (378 bp) score=10
OAN307_c00410 hypothetical protein OAN307:44.38..44.63 kbp (261 bp) score=10
OAN307_c00420 hypothetical protein OAN307:44.76..44.94 kbp (189 bp) score=10
OAN307_c00450 hypothetical protein OAN307:47.04..47.63 kbp (591 bp) score=10
OAN307_c00580 hypothetical protein OAN307:60.17..61.51 kbp (1.341 kbp) score=10
OAN307_c00660 hypothetical membrane protein DUF6 OAN307:68.68..69.58 kbp (894 bp) score=10
OAN307_c00670 hypothetical protein OAN307:69.58..70.41 kbp (831 bp) score=10
OAN307_c00700 hypothetical protein OAN307:72.99..73.95 kbp (966 bp) score=10
OAN307_c00720 hypothetical protein OAN307:74.99..75.44 kbp (447 bp) score=10
OAN307_c00790 hypothetical protein; transposase(fragment)-like OAN307:80.74..81.2 kbp (459 bp) score=10
OAN307_c00840 hypothetical protein OAN307:86.17..86.52 kbp (348 bp) score=10
OAN307_c00860 hypothetical protein OAN307:89.04..89.49 kbp (453 bp) score=10
OAN307_c00870 hypothetical protein; transposase(fragment)-like OAN307:89.58..90.08 kbp (495 bp) score=10
OAN307_c00880 hypothetical protein OAN307:90.44..90.93 kbp (495 bp) score=10
OAN307_c00890 hypothetical protein OAN307:90.96..91.46 kbp (501 bp) score=10
OAN307_c00910 hypothetical protein OAN307:92.63..93.2 kbp (564 bp) score=10
OAN307_c00940 hypothetical protein OAN307:95.64..96.7 kbp (1.062 kbp) score=10
OAN307_c00950 hypothetical protein OAN307:96.95..97.21 kbp (261 bp) score=10
OAN307_c00960 hypothetical protein OAN307:97.88..98.09 kbp (216 bp) score=10
OAN307_c00990 hypothetical protein OAN307:101.3..101.6 kbp (267 bp) score=10
OAN307_c01030 hypothetical protein OAN307:105.2..105.6 kbp (399 bp) score=10
OAN307_c01040 hypothetical protein OAN307:105.9..106.5 kbp (600 bp) score=10
OAN307_c01050 hypothetical protein OAN307:106.5..107.4 kbp (936 bp) score=10
OAN307_c01130 hypothetical protein OAN307:113.8..114.4 kbp (624 bp) score=10
OAN307_c01260 hypothetical protein OAN307:126.4..127.4 kbp (990 bp) score=10
OAN307_c01310 hypothetical protein OAN307:131.8..132 kbp (180 bp) score=10
OAN307_c01320 hypothetical protein OAN307:132.2..132.9 kbp (717 bp) score=10
OAN307_c01330 hypothetical protein OAN307:132.9..133.6 kbp (633 bp) score=10
OAN307_c01340 hypothetical protein OAN307:133.6..133.8 kbp (219 bp) score=10
OAN307_c01350 hypothetical protein OAN307:134.4..134.8 kbp (402 bp) score=10
OAN307_c01370 hypothetical protein OAN307:136.6..137.7 kbp (1.017 kbp) score=10
OAN307_c01400 hypothetical protein; transposase(fragment)-like OAN307:139.1..139.3 kbp (195 bp) score=10
OAN307_c01620 hypothetical protein OAN307:158.8..159.2 kbp (321 bp) score=10
OAN307_c01700 hypothetical protein OAN307:166.6..167.6 kbp (1.014 kbp) score=10
OAN307_c01710 hypothetical protein OAN307:167.6..168.2 kbp (588 bp) score=10
OAN307_c01720 putative molybdopterin-guanine dinucleotide biosynthesis protein A OAN307:168.2..168.8 kbp (582 bp) score=10
OAN307_c01750 hypothetical protein OAN307:169.9..170.5 kbp (624 bp) score=10
OAN307_c01760 hypothetical protein OAN307:170.7..171.2 kbp (456 bp) score=10
OAN307_c01810 hypothetical protein DUF179 OAN307:175.9..176.5 kbp (567 bp) score=10
OAN307_c01820 hypothetical protein OAN307:176.6..177.4 kbp (804 bp) score=10
OAN307_c01840 hypothetical protein OAN307:179.4..179.6 kbp (267 bp) score=10
OAN307_c01860 hypothetical protein OAN307:180.1..180.9 kbp (819 bp) score=10
OAN307_c01880 hypothetical protein OAN307:182.7..183.2 kbp (486 bp) score=10
OAN307_c01890 hypothetical protein OAN307:183.2..184.2 kbp (1.023 kbp) score=10
OAN307_c01900 hypothetical protein OAN307:184.4..185.7 kbp (1.272 kbp) score=10
OAN307_c01910 hypothetical protein OAN307:186.1..186.5 kbp (387 bp) score=10
OAN307_c01920 hypothetical protein OAN307:186.5..187 kbp (453 bp) score=10
OAN307_c01930 hypothetical protein OAN307:187.7..187.8 kbp (159 bp) score=10
moaB molybdenum cofactor biosynthesis protein MoaB OAN307:193.1..193.6 kbp (540 bp) score=10
OAN307_c01990 hypothetical protein OAN307:195.5..195.9 kbp (417 bp) score=10
OAN307_c02000 hypothetical protein OAN307:195.9..196.5 kbp (546 bp) score=10
OAN307_c02020 hypothetical protein DUF25 OAN307:197.8..198.4 kbp (606 bp) score=10
OAN307_c02030 hypothetical protein OAN307:198.4..198.6 kbp (252 bp) score=10
OAN307_c02050 hypothetical protein OAN307:200.1..200.6 kbp (522 bp) score=10
OAN307_c02090 hypothetical protein OAN307:204.4..204.8 kbp (330 bp) score=10
OAN307_c02100 hypothetical protein OAN307:204.8..205.3 kbp (585 bp) score=10
OAN307_c02130 hypothetical protein OAN307:208.6..211.2 kbp (2.58 kbp) score=10
OAN307_c02140 hypothetical protein OAN307:211.2..212 kbp (819 bp) score=10
OAN307_c02180 hypothetical protein OAN307:214.5..215.1 kbp (600 bp) score=10
OAN307_c02190 hypothetical protein OAN307:215.1..215.6 kbp (561 bp) score=10
OAN307_c02200 hypothetical protein OAN307:215.6..216.1 kbp (495 bp) score=10
OAN307_c02230 hypothetical protein DUF1611 OAN307:218.6..219.6 kbp (1.002 kbp) score=10
OAN307_c02270 hypothetical protein OAN307:223.7..224.4 kbp (660 bp) score=10
OAN307_c02280 hypothetical protein DUF1244 OAN307:224.5..224.8 kbp (339 bp) score=10
OAN307_c02310 hypothetical protein OAN307:227.2..227.4 kbp (225 bp) score=10
OAN307_c02410 hypothetical protein OAN307:237.7..237.8 kbp (168 bp) score=10
OAN307_c02440 hypothetical protein OAN307:240.6..241.8 kbp (1.134 kbp) score=10
OAN307_c02550 hypothetical protein OAN307:255..255.4 kbp (408 bp) score=10
OAN307_c02570 hypothetical protein; transposase(fragment)-like OAN307:256.2..256.5 kbp (279 bp) score=10
OAN307_c02580 hypothetical protein OAN307:257.1..257.3 kbp (249 bp) score=10
OAN307_c02590 hypothetical protein OAN307:257.8..258.1 kbp (270 bp) score=10
OAN307_c02690 hypothetical protein OAN307:271.9..272.9 kbp (909 bp) score=10
cobD cobalamin biosynthesis protein cobD OAN307:274.1..275 kbp (906 bp) score=10
OAN307_c02740 hypothetical protein OAN307:276.4..277.3 kbp (975 bp) score=10
OAN307_c02750 hypothetical protein OAN307:277.7..277.9 kbp (234 bp) score=10
OAN307_c02820 hypothetical protein OAN307:284.7..285.1 kbp (348 bp) score=10
OAN307_c02910 hypothetical protein DUF88 OAN307:291.5..292.1 kbp (588 bp) score=10
OAN307_c02950 hypothetical protein DUF262 OAN307:295.5..296.1 kbp (657 bp) score=10
OAN307_c02970 hypothetical protein OAN307:297..297.3 kbp (312 bp) score=10
OAN307_c02980 hypothetical protein OAN307:297.3..297.8 kbp (456 bp) score=10
OAN307_c03040 hypothetical protein OAN307:301.4..301.7 kbp (333 bp) score=10
OAN307_c03070 hypothetical protein OAN307:302.9..303.5 kbp (609 bp) score=10
OAN307_c03100 hypothetical protein OAN307:306.2..306.8 kbp (582 bp) score=10
OAN307_c03160 hypothetical protein OAN307:312.5..312.9 kbp (405 bp) score=10
OAN307_c03180 hypothetical protein OAN307:313.2..314.1 kbp (876 bp) score=10
OAN307_c03200 hypothetical protein OAN307:315.2..316 kbp (819 bp) score=10
OAN307_c03240 hypothetical protein OAN307:318.4..318.6 kbp (204 bp) score=10
OAN307_c03260 hypothetical protein OAN307:319.7..320.1 kbp (411 bp) score=10
OAN307_c03310 hypothetical protein OAN307:326.4..327.1 kbp (678 bp) score=10
OAN307_c03330 hypothetical protein; EF-Tu central fragment-like OAN307:328.4..328.8 kbp (385 bp) score=10
OAN307_c03340 hypothetical protein OAN307:329.2..330.3 kbp (1.02 kbp) score=10
OAN307_c03360 hypothetical protein OAN307:330.5..331.4 kbp (843 bp) score=10
OAN307_c03470 hypothetical protein OAN307:338.4..338.9 kbp (501 bp) score=10
OAN307_c03480 hypothetical protein OAN307:339.2..339.7 kbp (486 bp) score=10
OAN307_c03490 hypothetical protein OAN307:339.7..340 kbp (285 bp) score=10
OAN307_c03500 hypothetical protein OAN307:340.3..340.7 kbp (447 bp) score=10
OAN307_c03510 hypothetical protein OAN307:340.8..341 kbp (231 bp) score=10
OAN307_c03520 hypothetical protein OAN307:341..341.4 kbp (330 bp) score=10
OAN307_c03530 hypothetical protein OAN307:341.4..341.8 kbp (366 bp) score=10
OAN307_c03560 hypothetical protein OAN307:343.2..343.7 kbp (531 bp) score=10
OAN307_c03640 hypothetical protein OAN307:351.5..351.9 kbp (402 bp) score=10
moaA2 molybdenum cofactor biosynthesis protein MoaA OAN307:352.8..353.8 kbp (1.005 kbp) score=10
OAN307_c03680 hypothetical protein OAN307:355.1..355.4 kbp (303 bp) score=10
OAN307_c03700 hypothetical protein OAN307:356.5..357.4 kbp (834 bp) score=10
OAN307_c03710 hypothetical protein OAN307:357.4..357.6 kbp (210 bp) score=10
OAN307_c03720 hypothetical protein OAN307:357.9..358.3 kbp (399 bp) score=10
OAN307_c03730 hypothetical protein OAN307:358.4..358.9 kbp (510 bp) score=10
OAN307_c03810 hypothetical protein OAN307:367..367.2 kbp (291 bp) score=10
OAN307_c03820 hypothetical protein OAN307:367.3..367.6 kbp (309 bp) score=10
OAN307_c03830 hypothetical protein OAN307:367.6..368.1 kbp (507 bp) score=10
OAN307_c03840 hypothetical protein OAN307:368.6..369 kbp (330 bp) score=10
OAN307_c03850 hypothetical protein OAN307:369.1..369.4 kbp (330 bp) score=10
OAN307_c03860 hypothetical protein OAN307:369.4..369.6 kbp (222 bp) score=10
OAN307_c03870 hypothetical protein OAN307:369.9..370.3 kbp (432 bp) score=10
OAN307_c03880 hypothetical protein OAN307:370.3..371.5 kbp (1.212 kbp) score=10
OAN307_c03910 hypothetical protein OAN307:373.7..374 kbp (279 bp) score=10
OAN307_c03920 hypothetical protein OAN307:374.2..374.4 kbp (195 bp) score=10
OAN307_c03990 hypothetical protein OAN307:378.7..380.1 kbp (1.425 kbp) score=10
OAN307_c04000 hypothetical protein OAN307:381.1..381.4 kbp (321 bp) score=10
pheS phenylalanyl-tRNA synthetase alpha chain OAN307:381.7..382.7 kbp (1.065 kbp) score=10
OAN307_c04020 hypothetical protein OAN307:382.7..383.4 kbp (642 bp) score=10
OAN307_c04030 hypothetical protein OAN307:383.4..383.8 kbp (438 bp) score=10
pheT phenylalanyl-tRNA synthetase beta chain OAN307:383.8..386.2 kbp (2.4 kbp) score=10
OAN307_c04060 hypothetical protein OAN307:387.2..387.8 kbp (633 bp) score=10
OAN307_c04070 hypothetical protein OAN307:387.9..388.3 kbp (447 bp) score=10
OAN307_c04130 hypothetical protein OAN307:392.8..394.2 kbp (1.425 kbp) score=10
OAN307_c04150 putative ubiquinone biosynthesis protein COQ9 OAN307:395.4..396.1 kbp (693 bp) score=10
OAN307_c04180 hypothetical protein; transposase(fragment)-like OAN307:398.2..399.7 kbp (1.491 kbp) score=10
OAN307_c04200 hypothetical protein OAN307:400.9..401.1 kbp (264 bp) score=10
OAN307_c04210 hypothetical protein OAN307:401.2..401.5 kbp (306 bp) score=10
OAN307_c04240 hypothetical protein OAN307:403.8..404.4 kbp (543 bp) score=10
OAN307_c04260 hypothetical protein OAN307:405.9..406.7 kbp (840 bp) score=10
OAN307_c04300 hypothetical protein OAN307:409.8..410.1 kbp (285 bp) score=10
OAN307_c04310 hypothetical protein OAN307:410.2..410.6 kbp (396 bp) score=10
OAN307_c04350 hypothetical protein OAN307:416..416.5 kbp (471 bp) score=10
OAN307_c04380 hypothetical protein OAN307:418.4..419.5 kbp (1.101 kbp) score=10
OAN307_c04420 hypothetical protein DUF318 OAN307:422.4..423.5 kbp (1.053 kbp) score=10
OAN307_c04480 hypothetical protein OAN307:429.6..430.3 kbp (789 bp) score=10
OAN307_c04490 hypothetical protein OAN307:430.4..431.4 kbp (1.071 kbp) score=10
OAN307_c04500 hypothetical protein OAN307:431.4..432.3 kbp (912 bp) score=10
OAN307_c04610 hypothetical protein OAN307:441.5..443 kbp (1.425 kbp) score=10
OAN307_c04740 hypothetical protein OAN307:457.3..457.6 kbp (324 bp) score=10
OAN307_c04760 hypothetical protein OAN307:458.5..458.9 kbp (405 bp) score=10
OAN307_c04780 hypothetical protein OAN307:460.3..461.2 kbp (828 bp) score=10
OAN307_c04790 hypothetical protein OAN307:461.2..461.5 kbp (336 bp) score=10
OAN307_c04800 hypothetical protein OAN307:461.7..462 kbp (300 bp) score=10
OAN307_c04860 hypothetical protein DUF188 OAN307:466.5..467 kbp (498 bp) score=10
OAN307_c04910 hypothetical protein OAN307:470.9..471.3 kbp (318 bp) score=10
OAN307_c04920 hypothetical protein OAN307:471.5..471.7 kbp (180 bp) score=10
OAN307_c04930 hypothetical protein OAN307:471.8..472.2 kbp (447 bp) score=10
OAN307_c04940 hypothetical protein OAN307:472.7..473.3 kbp (564 bp) score=10
OAN307_c04960 hypothetical protein OAN307:474.6..475 kbp (393 bp) score=10
OAN307_c04980 hypothetical protein OAN307:475.9..476.8 kbp (861 bp) score=10
OAN307_c04990 hypothetical protein OAN307:476.8..477.2 kbp (372 bp) score=10
OAN307_c05010 hypothetical protein OAN307:479..479.7 kbp (684 bp) score=10
OAN307_c05020 hypothetical protein OAN307:479.8..480.6 kbp (774 bp) score=10
OAN307_c05030 hypothetical protein OAN307:480.6..481 kbp (393 bp) score=10
OAN307_c05050 hypothetical protein OAN307:483.2..483.4 kbp (201 bp) score=10
OAN307_c05080 hypothetical protein OAN307:485.2..485.8 kbp (642 bp) score=10
OAN307_c05100 hypothetical protein OAN307:487.1..487.4 kbp (327 bp) score=10
OAN307_c05120 hypothetical protein OAN307:488.3..488.9 kbp (570 bp) score=10
OAN307_c05130 hypothetical protein OAN307:488.9..489.6 kbp (714 bp) score=10
OAN307_c05140 hypothetical protein OAN307:489.6..490.4 kbp (723 bp) score=10
OAN307_c05220 hypothetical protein DUF482 OAN307:495.2..496.2 kbp (918 bp) score=10
OAN307_c05290 hypothetical protein OAN307:502.3..502.6 kbp (348 bp) score=10
OAN307_c05370 hypothetical protein DUF16 OAN307:510.5..511.7 kbp (1.194 kbp) score=10
OAN307_c05380 hypothetical protein OAN307:511.7..512.9 kbp (1.2 kbp) score=10
OAN307_c05400 hypothetical protein OAN307:514..516.2 kbp (2.163 kbp) score=10
OAN307_c05420 hypothetical protein DUF752 OAN307:517.1..517.7 kbp (672 bp) score=10
OAN307_c05440 hypothetical protein OAN307:518.9..519.7 kbp (795 bp) score=10
OAN307_c05530 hypothetical protein OAN307:526.2..526.5 kbp (309 bp) score=10
OAN307_c05540 hypothetical protein; transposase(fragment)-like OAN307:526.8..527.1 kbp (270 bp) score=10
OAN307_c05550 hypothetical protein; transposase(fragment)-like OAN307:527.1..527.3 kbp (258 bp) score=10
OAN307_c05560 hypothetical protein; transposase(fragment)-like OAN307:527.5..527.9 kbp (378 bp) score=10
OAN307_c05600 hypothetical protein OAN307:529.8..530.2 kbp (417 bp) score=10
OAN307_c05690 hypothetical protein; transposase(fragment)-like OAN307:540.8..541.2 kbp (456 bp) score=10
OAN307_c05720 hypothetical protein; transposase(fragment)-like OAN307:542.5..542.7 kbp (225 bp) score=10
OAN307_c05730 hypothetical protein; transposase(fragment)-like OAN307:542.7..543.1 kbp (369 bp) score=10
OAN307_c05740 hypothetical protein; transposase(fragment)-like OAN307:542.9..543.6 kbp (657 bp) score=10
OAN307_c05760 hypothetical protein DUF113 OAN307:544.5..545.2 kbp (750 bp) score=10
OAN307_c05770 hypothetical protein OAN307:545.5..546.3 kbp (795 bp) score=10
OAN307_c05780 hypothetical protein OAN307:546.2..546.5 kbp (273 bp) score=10
OAN307_c05810 hypothetical protein OAN307:549.4..549.8 kbp (345 bp) score=10
OAN307_c05830 hypothetical protein OAN307:552.3..552.8 kbp (495 bp) score=10
OAN307_c05860 hypothetical protein OAN307:555.1..555.5 kbp (462 bp) score=10
OAN307_c05990 hypothetical protein OAN307:568.5..568.8 kbp (390 bp) score=10
OAN307_c06050 hypothetical protein OAN307:573.8..574 kbp (207 bp) score=10
OAN307_c06170 hypothetical protein OAN307:586.6..587.5 kbp (873 bp) score=10
OAN307_c06180 hypothetical protein OAN307:587.5..588.3 kbp (810 bp) score=10
OAN307_c06190 hypothetical protein OAN307:588.3..588.4 kbp (141 bp) score=10
OAN307_c06210 hypothetical protein OAN307:591.3..592 kbp (765 bp) score=10
OAN307_c06300 hypothetical protein OAN307:603.8..604.3 kbp (474 bp) score=10
OAN307_c06320 hypothetical protein OAN307:605.9..606.3 kbp (336 bp) score=10
OAN307_c06370 hypothetical protein OAN307:608.8..609.6 kbp (801 bp) score=10
OAN307_c06410 hypothetical protein OAN307:611.1..611.6 kbp (525 bp) score=10
OAN307_c06560 hypothetical protein OAN307:622.8..623.5 kbp (693 bp) score=10
OAN307_c06570 hypothetical protein OAN307:623.5..624.2 kbp (714 bp) score=10
OAN307_c06580 hypothetical protein OAN307:624.2..625 kbp (819 bp) score=10
OAN307_c06620 hypothetical protein OAN307:628.3..628.5 kbp (273 bp) score=10
OAN307_c06650 hypothetical protein OAN307:632.3..633.1 kbp (813 bp) score=10
OAN307_c06670 hypothetical protein OAN307:634.5..634.8 kbp (324 bp) score=10
OAN307_c06700 hypothetical protein DUF599 OAN307:637.4..638.2 kbp (786 bp) score=10
OAN307_c06710 hypothetical protein DUF1355 OAN307:638.4..640.5 kbp (2.073 kbp) score=10
OAN307_c06720 hypothetical protein OAN307:640.6..643.4 kbp (2.769 kbp) score=10
OAN307_c06730 hypothetical protein OAN307:643.5..644.1 kbp (696 bp) score=10
OAN307_c06750 hypothetical protein DUF1285 OAN307:645.4..646 kbp (594 bp) score=10
OAN307_c06760 hypothetical protein OAN307:646.1..646.6 kbp (510 bp) score=10
OAN307_c06820 hypothetical protein OAN307:652.5..653.3 kbp (789 bp) score=10
OAN307_c06830 hypothetical protein OAN307:653.6..654 kbp (363 bp) score=10
OAN307_c06850 hypothetical protein OAN307:654.9..655.6 kbp (777 bp) score=10
OAN307_c06860 hypothetical protein OAN307:655.7..656.8 kbp (1.137 kbp) score=10
OAN307_c06870 hypothetical protein OAN307:657.1..658.2 kbp (1.119 kbp) score=10
OAN307_c06890 hypothetical protein OAN307:660.2..660.6 kbp (345 bp) score=10
OAN307_c06900 hypothetical protein OAN307:660.6..661 kbp (450 bp) score=10
OAN307_c06910 hypothetical protein OAN307:661..662.4 kbp (1.353 kbp) score=10
OAN307_c06920 hypothetical protein OAN307:662.4..662.7 kbp (261 bp) score=10
OAN307_c06930 hypothetical protein DUF1523 OAN307:662.7..663.3 kbp (678 bp) score=10
OAN307_c06990 hypothetical protein OAN307:669.5..669.9 kbp (339 bp) score=10
OAN307_c07000 hypothetical protein OAN307:669.8..670.2 kbp (318 bp) score=10
OAN307_c07080 hypothetical protein OAN307:679.4..680.2 kbp (840 bp) score=10
OAN307_c07180 hypothetical protein OAN307:691..692.5 kbp (1.518 kbp) score=10
OAN307_c07260 hypothetical protein OAN307:701.1..701.8 kbp (753 bp) score=10
OAN307_c07270 hypothetical protein OAN307:701.8..702 kbp (156 bp) score=10
OAN307_c07340 hypothetical protein OAN307:709..709.4 kbp (378 bp) score=10
OAN307_c07380 hypothetical protein OAN307:711.3..711.6 kbp (261 bp) score=10
OAN307_c07400 hypothetical protein OAN307:713.1..713.4 kbp (282 bp) score=10
OAN307_c07410 hypothetical protein OAN307:713.9..714.2 kbp (318 bp) score=10
OAN307_c07420 hypothetical protein OAN307:715..715.2 kbp (153 bp) score=10
OAN307_c07430 hypothetical protein OAN307:715.2..715.4 kbp (231 bp) score=10
OAN307_c07500 hypothetical protein OAN307:722.8..723.4 kbp (555 bp) score=10
OAN307_c07550 hypothetical protein OAN307:729..729.9 kbp (879 bp) score=10
OAN307_c07580 hypothetical protein OAN307:731.9..732.5 kbp (630 bp) score=10
OAN307_c07690 hypothetical protein OAN307:743.7..744.1 kbp (405 bp) score=10
OAN307_c07700 hypothetical protein OAN307:744.1..745.5 kbp (1.416 kbp) score=10
OAN307_c07720 hypothetical protein OAN307:746.9..747.4 kbp (435 bp) score=10
OAN307_c07730 hypothetical protein OAN307:748.5..748.9 kbp (450 bp) score=10
OAN307_c07870 hypothetical protein OAN307:762.6..763.2 kbp (603 bp) score=10
OAN307_c07920 hypothetical protein OAN307:767.7..768.4 kbp (675 bp) score=10
OAN307_c07930 hypothetical protein OAN307:768.4..768.7 kbp (297 bp) score=10
OAN307_c07940 hypothetical protein OAN307:768.7..768.9 kbp (240 bp) score=10
OAN307_c07970 hypothetical protein OAN307:771.5..772.3 kbp (741 bp) score=10
OAN307_c08000 hypothetical protein OAN307:774.2..775.2 kbp (978 bp) score=10
OAN307_c08010 hypothetical protein OAN307:775.4..775.6 kbp (216 bp) score=10
OAN307_c08030 hypothetical protein OAN307:778.3..778.6 kbp (312 bp) score=10
OAN307_c08070 hypothetical protein; interrupted by frameshift OAN307:781..782.3 kbp (1.211 kbp) score=10
OAN307_c08120 hypothetical protein OAN307:786.3..787.2 kbp (834 bp) score=10
OAN307_c08160 hypothetical protein OAN307:791.3..792 kbp (633 bp) score=10
OAN307_c08210 hypothetical protein OAN307:796.8..797.3 kbp (495 bp) score=10
OAN307_c08220 hypothetical protein OAN307:797.5..797.8 kbp (309 bp) score=10
OAN307_c08230 hypothetical protein OAN307:797.8..798.2 kbp (393 bp) score=10
OAN307_c08250 hypothetical protein OAN307:799.4..800.8 kbp (1.44 kbp) score=10
nadE glutamine-dependent NAD[+] synthetase NadE OAN307:801..802.6 kbp (1.686 kbp) score=10
OAN307_c08270 hypothetical protein OAN307:802.8..803.3 kbp (534 bp) score=10
OAN307_c08320 hypothetical protein OAN307:810.8..811.5 kbp (747 bp) score=10
OAN307_c08330 hypothetical protein OAN307:811.6..812 kbp (465 bp) score=10
OAN307_c08340 hypothetical protein OAN307:812..813.2 kbp (1.179 kbp) score=10
OAN307_c08410 hypothetical protein OAN307:820.5..820.8 kbp (351 bp) score=10
OAN307_c08430 hypothetical protein OAN307:822..822.6 kbp (597 bp) score=10
ribF riboflavin biosynthesis protein RibF OAN307:824.2..825.1 kbp (972 bp) score=10
OAN307_c08480 hypothetical protein OAN307:825.7..826.6 kbp (873 bp) score=10
OAN307_c08500 hypothetical protein DUF261 OAN307:828..828.8 kbp (786 bp) score=10
OAN307_c08550 hypothetical protein OAN307:832.6..833.5 kbp (885 bp) score=10
OAN307_c08580 hypothetical protein DUF465 OAN307:835.2..835.6 kbp (339 bp) score=10
OAN307_c08600 hypothetical protein DUF115 OAN307:836.1..836.3 kbp (237 bp) score=10
OAN307_c08610 hypothetical protein OAN307:836.4..836.6 kbp (213 bp) score=10
OAN307_c08630 hypothetical protein OAN307:839.4..839.9 kbp (483 bp) score=10
OAN307_c08660 hypothetical protein OAN307:841.8..842.6 kbp (801 bp) score=10
OAN307_c08680 hypothetical protein DUF185 OAN307:844.1..845.2 kbp (1.107 kbp) score=10
OAN307_c08700 hypothetical protein OAN307:846.5..846.8 kbp (306 bp) score=10
ileS isoleucyl-tRNA synthetase IleS OAN307:846.9..850 kbp (3.027 kbp) score=10
OAN307_c08730 hypothetical protein OAN307:850.5..851.2 kbp (696 bp) score=10
OAN307_c08750 hypothetical protein OAN307:852.2..852.9 kbp (723 bp) score=10
OAN307_c08770 hypothetical protein OAN307:853.8..854.1 kbp (348 bp) score=10
OAN307_c08790 hypothetical protein OAN307:856.4..857.6 kbp (1.233 kbp) score=10
OAN307_c08810 hypothetical protein OAN307:858.6..858.9 kbp (333 bp) score=10
OAN307_c08820 hypothetical protein OAN307:859.1..859.3 kbp (198 bp) score=10
OAN307_c08860 hypothetical protein OAN307:861.9..862.6 kbp (624 bp) score=10
OAN307_c08900 hypothetical protein OAN307:864.2..865.4 kbp (1.122 kbp) score=10
OAN307_c08930 hypothetical protein OAN307:867.4..868.2 kbp (816 bp) score=10
OAN307_c08960 hypothetical protein OAN307:871.7..872.3 kbp (582 bp) score=10
OAN307_c08990 hypothetical protein OAN307:875.1..875.8 kbp (672 bp) score=10
OAN307_c09010 hypothetical protein OAN307:878.4..879.7 kbp (1.311 kbp) score=10
OAN307_c09020 hypothetical protein OAN307:879.8..881.5 kbp (1.692 kbp) score=10
OAN307_c09040 hypothetical protein OAN307:882..882.9 kbp (858 bp) score=10
OAN307_c09050 hypothetical protein OAN307:882.9..883.4 kbp (543 bp) score=10
OAN307_c09090 hypothetical protein OAN307:886.9..888.2 kbp (1.245 kbp) score=10
OAN307_c09120 hypothetical protein OAN307:890.8..891.7 kbp (861 bp) score=10
OAN307_c09130 hypothetical protein OAN307:891.9..892 kbp (186 bp) score=10
OAN307_c09200 hypothetical protein OAN307:898.6..899.4 kbp (792 bp) score=10
OAN307_c09220 hypothetical protein; transposase(fragment)-like OAN307:901.6..902 kbp (436 bp) score=10
OAN307_c09230 hypothetical protein OAN307:902.7..903 kbp (264 bp) score=10
OAN307_c09240 hypothetical protein OAN307:903.2..904.1 kbp (966 bp) score=10
OAN307_c09290 hypothetical protein OAN307:910.1..911.6 kbp (1.473 kbp) score=10
OAN307_c09310 hypothetical protein OAN307:912.3..913.4 kbp (1.101 kbp) score=10
OAN307_c09320 hypothetical protein OAN307:913.4..914 kbp (594 bp) score=10
OAN307_c09340 hypothetical protein OAN307:915.5..916.1 kbp (633 bp) score=10
OAN307_c09350 hypothetical protein OAN307:916.8..917.1 kbp (339 bp) score=10
OAN307_c09360 hypothetical protein OAN307:917.1..917.4 kbp (309 bp) score=10
OAN307_c09370 associated with polysaccharide biosynthesis OAN307:917.7..918.8 kbp (1.14 kbp) score=10
OAN307_c09380 CapD-like, associated with polysaccharide biosynthesis OAN307:918.8..919.8 kbp (999 bp) score=10
OAN307_c09390 hypothetical protein OAN307:920.6..921 kbp (486 bp) score=10
OAN307_c09400 hypothetical protein OAN307:921.1..921.5 kbp (396 bp) score=10
OAN307_c09410 hypothetical protein; transposase(fragment)-like OAN307:921.7..921.9 kbp (270 bp) score=10
OAN307_c09460 hypothetical protein OAN307:929.3..930.4 kbp (1.035 kbp) score=10
OAN307_c09500 hypothetical protein DUF1636 OAN307:933.4..933.8 kbp (408 bp) score=10
OAN307_c09510 hypothetical protein OAN307:934.4..934.5 kbp (153 bp) score=10
OAN307_c09530 hypothetical protein OAN307:935.3..935.5 kbp (222 bp) score=10
OAN307_c09620 hypothetical protein OAN307:950.8..951 kbp (225 bp) score=10
OAN307_c09730 hypothetical protein OAN307:963.4..967.1 kbp (3.756 kbp) score=10
OAN307_c09760 hypothetical protein OAN307:970.2..971.8 kbp (1.647 kbp) score=10
OAN307_c09770 hypothetical protein OAN307:971.8..972.3 kbp (492 bp) score=10
OAN307_c09800 hypothetical protein OAN307:974.6..975.6 kbp (1.014 kbp) score=10
OAN307_c09820 hypothetical protein DUF179 OAN307:976.9..977.4 kbp (504 bp) score=10
OAN307_c09870 hypothetical protein OAN307:980.3..981 kbp (636 bp) score=10
OAN307_c09890 hypothetical protein OAN307:981.8..982.6 kbp (843 bp) score=10
OAN307_c09900 hypothetical protein OAN307:982.7..983 kbp (354 bp) score=10
OAN307_c09910 hypothetical protein OAN307:983.1..983.5 kbp (414 bp) score=10
OAN307_c09930 hypothetical protein OAN307:984.8..985.5 kbp (609 bp) score=10
OAN307_c09940 hypothetical protein OAN307:985.5..985.6 kbp (174 bp) score=10
aspS aspartyl-tRNA synthetase AspS OAN307:990.1..992 kbp (1.854 kbp) score=10
OAN307_c09970 hypothetical protein OAN307:992.1..993.5 kbp (1.401 kbp) score=10
OAN307_c09980 hypothetical protein OAN307:993.5..994.8 kbp (1.218 kbp) score=10
OAN307_c09990 hypothetical protein OAN307:995..995.7 kbp (717 bp) score=10
OAN307_c10020 hypothetical protein DUF1467 OAN307:997.1..997.4 kbp (312 bp) score=10
OAN307_c10030 hypothetical protein OAN307:997.3..997.5 kbp (201 bp) score=10
OAN307_c10040 hypothetical protein OAN307:997.6..997.9 kbp (270 bp) score=10
OAN307_c10050 hypothetical protein DUF54 OAN307:997.9..998.6 kbp (696 bp) score=10
OAN307_c10080 hypothetical protein OAN307:999.7 kbp..1 Mbp (687 bp) score=10
OAN307_c10090 hypothetical protein DUF32 OAN307:1.001..1.001 Mbp (450 bp) score=10
OAN307_c10110 hypothetical protein OAN307:1.003..1.003 Mbp (255 bp) score=10
OAN307_c10130 hypothetical protein OAN307:1.004..1.005 Mbp (1.134 kbp) score=10
OAN307_c10160 hypothetical protein OAN307:1.006..1.007 Mbp (555 bp) score=10
OAN307_c10250 hypothetical protein DUF1445 OAN307:1.018..1.019 Mbp (825 bp) score=10
OAN307_c10300 hypothetical protein OAN307:1.025..1.026 Mbp (654 bp) score=10
OAN307_c10310 hypothetical protein OAN307:1.027..1.027 Mbp (189 bp) score=10
OAN307_c10360 hypothetical protein OAN307:1.03..1.031 Mbp (1.377 kbp) score=10
OAN307_c10380 hypothetical protein; integrase(fragment)-like OAN307:1.034..1.034 Mbp (702 bp) score=10
OAN307_c10400 hypothetical protein OAN307:1.035..1.036 Mbp (357 bp) score=10
OAN307_c10440 hypothetical protein OAN307:1.038..1.039 Mbp (933 bp) score=10
OAN307_c10450 hypothetical protein OAN307:1.039..1.04 Mbp (1.077 kbp) score=10
OAN307_c10470 hypothetical protein OAN307:1.042..1.042 Mbp (216 bp) score=10
OAN307_c10490 hypothetical protein; futA C-terminal fragment-like OAN307:1.042..1.043 Mbp (564 bp) score=10
OAN307_c10500 hypothetical protein OAN307:1.043..1.044 Mbp (495 bp) score=10
OAN307_c10540 hypothetical protein DUF1513 OAN307:1.047..1.048 Mbp (1.062 kbp) score=10
OAN307_c10550 hypothetical protein OAN307:1.048..1.049 Mbp (165 bp) score=10
OAN307_c10560 hypothetical protein; transposase(fragment)-like OAN307:1.049..1.05 Mbp (228 bp) score=10
OAN307_c10580 hypothetical protein OAN307:1.051..1.052 Mbp (270 bp) score=10
OAN307_c10590 hypothetical protein OAN307:1.052..1.052 Mbp (609 bp) score=10
OAN307_c10630 hypothetical protein DUF989 OAN307:1.055..1.056 Mbp (1.236 kbp) score=10
OAN307_c10690 hypothetical protein OAN307:1.061..1.062 Mbp (489 bp) score=10
OAN307_c10710 hypothetical protein OAN307:1.063..1.064 Mbp (1.167 kbp) score=10
OAN307_c10750 hypothetical protein OAN307:1.067..1.068 Mbp (864 bp) score=10
OAN307_c10760 hypothetical protein; integrase(fragment)-like OAN307:1.069..1.069 Mbp (387 bp) score=10
OAN307_c10780 hypothetical protein OAN307:1.071..1.071 Mbp (402 bp) score=10
OAN307_c10790 hypothetical protein OAN307:1.071..1.072 Mbp (519 bp) score=10
OAN307_c10800 hypothetical protein OAN307:1.072..1.072 Mbp (408 bp) score=10
OAN307_c10810 hypothetical protein OAN307:1.072..1.073 Mbp (186 bp) score=10
OAN307_c10820 hypothetical protein OAN307:1.073..1.073 Mbp (318 bp) score=10
OAN307_c10830 hypothetical protein OAN307:1.073..1.075 Mbp (1.431 kbp) score=10
OAN307_c10930 hypothetical protein OAN307:1.087..1.087 Mbp (216 bp) score=10
OAN307_c10940 hypothetical protein OAN307:1.087..1.088 Mbp (231 bp) score=10
OAN307_c10960 hypothetical protein OAN307:1.089..1.09 Mbp (327 bp) score=10
OAN307_c10980 hypothetical protein OAN307:1.096..1.097 Mbp (444 bp) score=10
OAN307_c10990 hypothetical protein OAN307:1.097..1.097 Mbp (180 bp) score=10
OAN307_c11010 hypothetical protein OAN307:1.098..1.098 Mbp (147 bp) score=10
OAN307_c11020 hypothetical protein OAN307:1.099..1.099 Mbp (444 bp) score=10
OAN307_c11030 hypothetical protein OAN307:1.1..1.1 Mbp (297 bp) score=10
OAN307_c11040 hypothetical protein OAN307:1.1..1.101 Mbp (342 bp) score=10
OAN307_c11060 hypothetical protein OAN307:1.102..1.103 Mbp (219 bp) score=10
OAN307_c11070 hypothetical protein OAN307:1.103..1.107 Mbp (3.255 kbp) score=10
OAN307_c11080 hypothetical protein OAN307:1.107..1.109 Mbp (2.022 kbp) score=10
OAN307_c11130 hypothetical protein OAN307:1.112..1.115 Mbp (3.435 kbp) score=10
OAN307_c11210 hypothetical protein OAN307:1.123..1.123 Mbp (312 bp) score=10
OAN307_c11240 hypothetical protein OAN307:1.125..1.126 Mbp (492 bp) score=10
OAN307_c11250 hypothetical protein OAN307:1.126..1.126 Mbp (597 bp) score=10
OAN307_c11260 hypothetical protein OAN307:1.126..1.127 Mbp (561 bp) score=10
OAN307_c11270 hypothetical protein OAN307:1.127..1.129 Mbp (1.773 kbp) score=10
OAN307_c11390 hypothetical protein OAN307:1.144..1.145 Mbp (666 bp) score=10
OAN307_c11410 hypothetical protein OAN307:1.146..1.147 Mbp (1.392 kbp) score=10
OAN307_c11440 hypothetical protein OAN307:1.15..1.151 Mbp (423 bp) score=10
OAN307_c11450 hypothetical protein OAN307:1.151..1.152 Mbp (375 bp) score=10
OAN307_c11460 hypothetical protein OAN307:1.152..1.152 Mbp (660 bp) score=10
OAN307_c11480 hypothetical protein OAN307:1.154..1.155 Mbp (771 bp) score=10
OAN307_c11490 hypothetical protein OAN307:1.155..1.156 Mbp (552 bp) score=10
OAN307_c11510 hypothetical protein OAN307:1.158..1.159 Mbp (597 bp) score=10
OAN307_c11520 hypothetical protein OAN307:1.159..1.159 Mbp (477 bp) score=10
OAN307_c11550 hypothetical protein OAN307:1.161..1.161 Mbp (396 bp) score=10
OAN307_c11580 hypothetical protein OAN307:1.165..1.166 Mbp (693 bp) score=10
OAN307_c11590 hypothetical protein DUF2 OAN307:1.166..1.167 Mbp (1.128 kbp) score=10
OAN307_c11600 hypothetical protein OAN307:1.167..1.168 Mbp (513 bp) score=10
proS prolyl-tRNA synthetase ProS OAN307:1.168..1.169 Mbp (1.362 kbp) score=10
OAN307_c11650 hypothetical protein OAN307:1.172..1.173 Mbp (642 bp) score=10
OAN307_c11660 hypothetical protein OAN307:1.173..1.174 Mbp (678 bp) score=10
OAN307_c11680 hypothetical protein OAN307:1.174..1.175 Mbp (339 bp) score=10
OAN307_c11690 hypothetical protein OAN307:1.175..1.175 Mbp (297 bp) score=10
OAN307_c11710 hypothetical protein OAN307:1.176..1.176 Mbp (258 bp) score=10
OAN307_c11720 hypothetical protein OAN307:1.176..1.177 Mbp (825 bp) score=10
OAN307_c11730 hypothetical protein OAN307:1.177..1.177 Mbp (423 bp) score=10
OAN307_c11760 hypothetical protein OAN307:1.182..1.182 Mbp (324 bp) score=10
OAN307_c11780 hypothetical protein OAN307:1.185..1.185 Mbp (153 bp) score=10
OAN307_c11810 hypothetical protein OAN307:1.187..1.187 Mbp (219 bp) score=10
OAN307_c11860 hypothetical protein OAN307:1.191..1.191 Mbp (381 bp) score=10
ftsI putative peptidoglycan synthetase FtsI OAN307:1.191..1.193 Mbp (1.782 kbp) score=10
OAN307_c11910 hypothetical protein OAN307:1.197..1.198 Mbp (408 bp) score=10
OAN307_c11920 hypothetical protein OAN307:1.198..1.199 Mbp (411 bp) score=10
OAN307_c11960 hypothetical protein HI933 OAN307:1.202..1.203 Mbp (1.242 kbp) score=10
OAN307_c12000 hypothetical protein OAN307:1.207..1.207 Mbp (210 bp) score=10
OAN307_c12020 hypothetical protein DUF2484 OAN307:1.207..1.208 Mbp (252 bp) score=10
OAN307_c12130 hypothetical protein DUF427 OAN307:1.221..1.221 Mbp (342 bp) score=10
OAN307_c12170 hypothetical protein OAN307:1.226..1.226 Mbp (243 bp) score=10
OAN307_c12180 hypothetical protein OAN307:1.226..1.226 Mbp (210 bp) score=10
lpcC lipopolysaccharide core biosynthesis mannosyltransferase lpcC OAN307:1.227..1.228 Mbp (1.248 kbp) score=10
OAN307_c12200 hypothetical protein OAN307:1.228..1.229 Mbp (747 bp) score=10
OAN307_c12230 hypothetical protein OAN307:1.23..1.231 Mbp (579 bp) score=10
OAN307_c12260 hypothetical protein OAN307:1.233..1.234 Mbp (420 bp) score=10
OAN307_c12270 hypothetical protein OAN307:1.234..1.234 Mbp (252 bp) score=10
OAN307_c12340 hypothetical protein OAN307:1.242..1.243 Mbp (228 bp) score=10
OAN307_c12350 hypothetical protein OAN307:1.243..1.243 Mbp (207 bp) score=10
OAN307_c12360 hypothetical protein OAN307:1.243..1.243 Mbp (342 bp) score=10
OAN307_c12370 hypothetical protein OAN307:1.243..1.243 Mbp (159 bp) score=10
OAN307_c12400 hypothetical protein; transposase(fragment)-like OAN307:1.247..1.247 Mbp (450 bp) score=10
OAN307_c12410 hypothetical protein OAN307:1.247..1.248 Mbp (375 bp) score=10
OAN307_c12420 hypothetical protein/IS110-family transposase-fusion protein OAN307:1.248..1.249 Mbp (1.311 kbp) score=10
OAN307_c12440 hypothetical protein OAN307:1.25..1.25 Mbp (255 bp) score=10
OAN307_c12520 hypothetical protein OAN307:1.256..1.256 Mbp (387 bp) score=10
OAN307_c12590 hypothetical protein OAN307:1.265..1.265 Mbp (330 bp) score=10
moaA1 molybdenum cofactor biosynthesis protein MoaA OAN307:1.265..1.266 Mbp (912 bp) score=10
OAN307_c12610 hypothetical protein OAN307:1.266..1.266 Mbp (471 bp) score=10
OAN307_c12630 hypothetical protein OAN307:1.268..1.268 Mbp (477 bp) score=10
OAN307_c12640 hypothetical protein OAN307:1.268..1.268 Mbp (303 bp) score=10
OAN307_c12650 hypothetical protein OAN307:1.268..1.269 Mbp (624 bp) score=10
OAN307_c12700 hypothetical protein OAN307:1.272..1.273 Mbp (447 bp) score=10
OAN307_c12710 hypothetical protein OAN307:1.273..1.273 Mbp (357 bp) score=10
OAN307_c12730 hypothetical protein OAN307:1.274..1.274 Mbp (168 bp) score=10
OAN307_c12760 hypothetical protein OAN307:1.276..1.276 Mbp (330 bp) score=10
acsA acetyl-coenzyme A synthetase AcsA OAN307:1.276..1.278 Mbp (1.959 kbp) score=10
OAN307_c12820 hypothetical protein OAN307:1.282..1.284 Mbp (1.371 kbp) score=10
OAN307_c12830 hypothetical protein OAN307:1.284..1.285 Mbp (1.284 kbp) score=10
OAN307_c12860 hypothetical protein OAN307:1.289..1.29 Mbp (993 bp) score=10
OAN307_c12870 hypothetical protein DUF442 OAN307:1.29..1.29 Mbp (426 bp) score=10
OAN307_c12890 hypothetical protein OAN307:1.292..1.292 Mbp (216 bp) score=10
OAN307_c12900 hypothetical protein OAN307:1.292..1.292 Mbp (258 bp) score=10
OAN307_c12920 hypothetical protein OAN307:1.293..1.294 Mbp (876 bp) score=10
OAN307_c12940 hypothetical protein OAN307:1.295..1.296 Mbp (849 bp) score=10
OAN307_c12960 hypothetical protein OAN307:1.298..1.299 Mbp (1.809 kbp) score=10
OAN307_c12970 hypothetical protein OAN307:1.3..1.3 Mbp (324 bp) score=10
OAN307_c12980 hypothetical protein OAN307:1.3..1.301 Mbp (450 bp) score=10
OAN307_c12990 hypothetical protein OAN307:1.301..1.301 Mbp (570 bp) score=10
OAN307_c13000 hypothetical protein OAN307:1.302..1.302 Mbp (291 bp) score=10
OAN307_c13010 hypothetical protein OAN307:1.302..1.303 Mbp (846 bp) score=10
OAN307_c13020 hypothetical protein OAN307:1.303..1.304 Mbp (330 bp) score=10
OAN307_c13030 hypothetical protein OAN307:1.304..1.305 Mbp (909 bp) score=10
OAN307_c13060 hypothetical protein OAN307:1.308..1.309 Mbp (873 bp) score=10
OAN307_c13100 hypothetical protein OAN307:1.314..1.316 Mbp (1.65 kbp) score=10
OAN307_c13110 hypothetical protein OAN307:1.316..1.316 Mbp (570 bp) score=10
OAN307_c13120 hypothetical protein OAN307:1.317..1.317 Mbp (513 bp) score=10
OAN307_c13150 hypothetical protein; transposase(fragment)-like OAN307:1.32..1.32 Mbp (117 bp) score=10
OAN307_c13160 hypothetical protein OAN307:1.32..1.321 Mbp (423 bp) score=10
OAN307_c13170 hypothetical protein OAN307:1.321..1.321 Mbp (132 bp) score=10
OAN307_c13190 hypothetical protein OAN307:1.322..1.324 Mbp (2.373 kbp) score=10
OAN307_c13250 hypothetical protein OAN307:1.33..1.331 Mbp (672 bp) score=10
OAN307_c13260 hypothetical protein OAN307:1.331..1.332 Mbp (1.326 kbp) score=10
OAN307_c13280 hypothetical protein OAN307:1.334..1.335 Mbp (951 bp) score=10
OAN307_c13290 hypothetical protein OAN307:1.335..1.337 Mbp (1.728 kbp) score=10
OAN307_c13300 hypothetical protein OAN307:1.337..1.338 Mbp (417 bp) score=10
OAN307_c13390 hypothetical protein; transposase(fragment)-like OAN307:1.347..1.347 Mbp (432 bp) score=10
OAN307_c13400 hypothetical protein OAN307:1.347..1.348 Mbp (123 bp) score=10
OAN307_c13420 hypothetical protein OAN307:1.349..1.349 Mbp (453 bp) score=10
OAN307_c13430 hypothetical protein OAN307:1.349..1.349 Mbp (288 bp) score=10
OAN307_c13460 hypothetical protein; transposase(fragment)-like OAN307:1.353..1.354 Mbp (618 bp) score=10
OAN307_c13470 hypothetical protein OAN307:1.354..1.354 Mbp (207 bp) score=10
OAN307_c13520 hypothetical protein OAN307:1.358..1.358 Mbp (234 bp) score=10
OAN307_c13540 hypothetical protein OAN307:1.359..1.36 Mbp (165 bp) score=10
OAN307_c13560 hypothetical protein OAN307:1.36..1.36 Mbp (231 bp) score=10
OAN307_c13570 hypothetical protein OAN307:1.361..1.361 Mbp (243 bp) score=10
OAN307_c13600 hypothetical protein OAN307:1.363..1.364 Mbp (375 bp) score=10
OAN307_c13610 hypothetical protein OAN307:1.364..1.364 Mbp (177 bp) score=10
OAN307_c13630 hypothetical protein; transposase(fragment)-like OAN307:1.366..1.367 Mbp (566 bp) score=10
OAN307_c13660 hypothetical protein OAN307:1.369..1.369 Mbp (192 bp) score=10
OAN307_c13700 putative bacterial lipid A biosynthesis acyltransferase-family protein OAN307:1.375..1.375 Mbp (825 bp) score=10
OAN307_c13730 hypothetical protein OAN307:1.379..1.38 Mbp (1.464 kbp) score=10
OAN307_c13740 hypothetical protein OAN307:1.38..1.381 Mbp (738 bp) score=10
OAN307_c13820 hypothetical protein OAN307:1.389..1.389 Mbp (570 bp) score=10
OAN307_c13830 hypothetical protein OAN307:1.389..1.39 Mbp (1.026 kbp) score=10
OAN307_c13860 hypothetical protein OAN307:1.393..1.393 Mbp (636 bp) score=10
OAN307_c13870 hypothetical protein; transposase(fragment)-like OAN307:1.393..1.394 Mbp (580 bp) score=10
OAN307_c13880 hypothetical protein OAN307:1.394..1.396 Mbp (1.86 kbp) score=10
OAN307_c13890 hypothetical protein OAN307:1.396..1.398 Mbp (1.608 kbp) score=10
OAN307_c13920 hypothetical protein OAN307:1.4..1.401 Mbp (381 bp) score=10
OAN307_c14000 hypothetical protein OAN307:1.406..1.407 Mbp (504 bp) score=10
OAN307_c14020 hypothetical protein OAN307:1.408..1.408 Mbp (708 bp) score=10
OAN307_c14030 hypothetical protein OAN307:1.408..1.409 Mbp (561 bp) score=10
OAN307_c14060 hypothetical protein OAN307:1.411..1.411 Mbp (456 bp) score=10
OAN307_c14080 hypothetical protein OAN307:1.413..1.413 Mbp (456 bp) score=10
OAN307_c14090 hypothetical protein OAN307:1.414..1.414 Mbp (465 bp) score=10
OAN307_c14100 hypothetical protein OAN307:1.414..1.414 Mbp (300 bp) score=10
OAN307_c14140 associated with histidine biosynthesis OAN307:1.417..1.417 Mbp (387 bp) score=10
OAN307_c14170 hypothetical protein OAN307:1.419..1.419 Mbp (588 bp) score=10
OAN307_c14180 hypothetical protein OAN307:1.42..1.42 Mbp (357 bp) score=10
OAN307_c14190 hypothetical protein; transposase(fragment)-like OAN307:1.421..1.421 Mbp (189 bp) score=10
OAN307_c14200 hypothetical protein OAN307:1.421..1.421 Mbp (186 bp) score=10
OAN307_c14220 hypothetical protein OAN307:1.423..1.423 Mbp (369 bp) score=10
OAN307_c14240 hypothetical protein OAN307:1.424..1.425 Mbp (735 bp) score=10
OAN307_c14300 hypothetical protein OAN307:1.43..1.43 Mbp (906 bp) score=10
OAN307_c14320 hypothetical protein OAN307:1.431..1.432 Mbp (393 bp) score=10
OAN307_c14330 hypothetical protein OAN307:1.432..1.432 Mbp (522 bp) score=10
OAN307_c14350 hypothetical protein OAN307:1.433..1.433 Mbp (345 bp) score=10
OAN307_c14360 hypothetical protein OAN307:1.433..1.434 Mbp (456 bp) score=10
OAN307_c14380 hypothetical protein OAN307:1.435..1.436 Mbp (279 bp) score=10
OAN307_c14410 hypothetical protein OAN307:1.438..1.439 Mbp (378 bp) score=10
OAN307_c14440 hypothetical protein OAN307:1.44..1.441 Mbp (1.122 kbp) score=10
OAN307_c14450 hypothetical protein OAN307:1.441..1.441 Mbp (264 bp) score=10
OAN307_c14460 hypothetical protein OAN307:1.441..1.443 Mbp (1.113 kbp) score=10
OAN307_c14470 hypothetical protein OAN307:1.443..1.444 Mbp (939 bp) score=10
OAN307_c14490 hypothetical protein OAN307:1.445..1.446 Mbp (873 bp) score=10
OAN307_c14500 hypothetical protein OAN307:1.446..1.446 Mbp (195 bp) score=10
OAN307_c14550 hypothetical protein OAN307:1.45..1.45 Mbp (717 bp) score=10
OAN307_c14600 hypothetical protein OAN307:1.455..1.455 Mbp (219 bp) score=10
OAN307_c14660 hypothetical protein OAN307:1.461..1.461 Mbp (498 bp) score=10
OAN307_c14700 hypothetical protein OAN307:1.464..1.465 Mbp (921 bp) score=10
OAN307_c14710 hypothetical protein OAN307:1.465..1.466 Mbp (918 bp) score=10
OAN307_c14750 hypothetical protein DUF28 OAN307:1.471..1.472 Mbp (756 bp) score=10
OAN307_c14770 hypothetical protein OAN307:1.472..1.473 Mbp (888 bp) score=10
OAN307_c14800 hypothetical protein UPF47 OAN307:1.477..1.478 Mbp (429 bp) score=10
OAN307_c14820 hypothetical protein OAN307:1.479..1.48 Mbp (447 bp) score=10
ribD riboflavin biosynthesis protein RibD OAN307:1.481..1.482 Mbp (1.113 kbp) score=10
OAN307_c14890 hypothetical protein OAN307:1.487..1.488 Mbp (582 bp) score=10
OAN307_c14900 hypothetical protein OAN307:1.488..1.488 Mbp (261 bp) score=10
ribB riboflavin biosynthesis protein RibB OAN307:1.488..1.49 Mbp (1.149 kbp) score=10
OAN307_c14940 hypothetical protein OAN307:1.491..1.491 Mbp (342 bp) score=10
OAN307_c14950 hypothetical protein OAN307:1.491..1.492 Mbp (354 bp) score=10
OAN307_c14960 hypothetical protein OAN307:1.492..1.492 Mbp (198 bp) score=10
OAN307_c14970 hypothetical protein DUF152 OAN307:1.492..1.492 Mbp (477 bp) score=10
OAN307_c14980 hypothetical protein OAN307:1.492..1.493 Mbp (816 bp) score=10
OAN307_c15000 hypothetical protein OAN307:1.494..1.495 Mbp (999 bp) score=10
OAN307_c15010 hypothetical protein OAN307:1.495..1.495 Mbp (201 bp) score=10
OAN307_c15020 hypothetical protein OAN307:1.495..1.496 Mbp (345 bp) score=10
OAN307_c15030 hypothetical protein OAN307:1.496..1.496 Mbp (162 bp) score=10
OAN307_c15040 hypothetical protein OAN307:1.496..1.496 Mbp (591 bp) score=10
OAN307_c15080 hypothetical protein OAN307:1.5..1.5 Mbp (315 bp) score=10
OAN307_c15090 hypothetical protein OAN307:1.5..1.5 Mbp (270 bp) score=10
OAN307_c15120 hypothetical protein OAN307:1.504..1.505 Mbp (1.194 kbp) score=10
OAN307_c15140 hypothetical protein OAN307:1.506..1.507 Mbp (948 bp) score=10
OAN307_c15160 hypothetical protein OAN307:1.507..1.508 Mbp (573 bp) score=10
OAN307_c15250 hypothetical protein OAN307:1.519..1.519 Mbp (936 bp) score=10
OAN307_c15260 hypothetical protein OAN307:1.52..1.52 Mbp (351 bp) score=10
OAN307_c15270 hypothetical protein OAN307:1.52..1.521 Mbp (903 bp) score=10
OAN307_c15290 hypothetical protein OAN307:1.521..1.522 Mbp (327 bp) score=10
OAN307_c15300 hypothetical protein OAN307:1.522..1.523 Mbp (696 bp) score=10
OAN307_c15320 hypothetical protein OAN307:1.524..1.525 Mbp (1.179 kbp) score=10
OAN307_c15330 hypothetical protein OAN307:1.526..1.526 Mbp (147 bp) score=10
OAN307_c15360 hypothetical protein OAN307:1.527..1.528 Mbp (342 bp) score=10
OAN307_c15370 hypothetical protein OAN307:1.528..1.528 Mbp (216 bp) score=10
OAN307_c15400 hypothetical protein OAN307:1.532..1.533 Mbp (1.764 kbp) score=10
glyQ glycyl-tRNA synthetase alpha subunit GlyQ OAN307:1.534..1.534 Mbp (930 bp) score=10
OAN307_c15420 hypothetical protein OAN307:1.534..1.535 Mbp (549 bp) score=10
OAN307_c15460 hypothetical protein OAN307:1.541..1.542 Mbp (909 bp) score=10
OAN307_c15500 hypothetical protein OAN307:1.546..1.546 Mbp (354 bp) score=10
OAN307_c15510 hypothetical protein OAN307:1.546..1.546 Mbp (201 bp) score=10
OAN307_c15550 hypothetical protein OAN307:1.549..1.549 Mbp (252 bp) score=10
OAN307_c15560 hypothetical protein OAN307:1.549..1.55 Mbp (1.134 kbp) score=10
OAN307_c15570 hypothetical protein OAN307:1.55..1.55 Mbp (282 bp) score=10
OAN307_c15580 hypothetical protein OAN307:1.55..1.551 Mbp (309 bp) score=10
OAN307_c15600 hypothetical protein OAN307:1.552..1.553 Mbp (279 bp) score=10
OAN307_c15620 hypothetical protein OAN307:1.554..1.554 Mbp (447 bp) score=10
OAN307_c15630 hypothetical protein DUF339 OAN307:1.554..1.555 Mbp (276 bp) score=10
OAN307_c15670 hypothetical protein OAN307:1.558..1.558 Mbp (240 bp) score=10
OAN307_c15690 hypothetical protein OAN307:1.559..1.559 Mbp (177 bp) score=10
OAN307_c15700 hypothetical protein OAN307:1.56..1.56 Mbp (336 bp) score=10
OAN307_c15710 hypothetical protein OAN307:1.56..1.561 Mbp (942 bp) score=10
OAN307_c15720 hypothetical protein OAN307:1.561..1.563 Mbp (1.569 kbp) score=10
OAN307_c15760 hypothetical protein OAN307:1.566..1.567 Mbp (777 bp) score=10
OAN307_c15770 hypothetical protein OAN307:1.567..1.568 Mbp (747 bp) score=10
OAN307_c15780 hypothetical protein OAN307:1.568..1.569 Mbp (735 bp) score=10
OAN307_c15800 hypothetical protein OAN307:1.569..1.571 Mbp (1.374 kbp) score=10
OAN307_c15810 hypothetical protein OAN307:1.571..1.572 Mbp (1.149 kbp) score=10
OAN307_c15830 hypothetical protein OAN307:1.573..1.574 Mbp (1.077 kbp) score=10
OAN307_c15840 hypothetical protein OAN307:1.574..1.574 Mbp (129 bp) score=10
OAN307_c15850 hypothetical protein OAN307:1.574..1.575 Mbp (324 bp) score=10
OAN307_c15860 hypothetical protein OAN307:1.575..1.575 Mbp (366 bp) score=10
OAN307_c15880 hypothetical protein OAN307:1.576..1.576 Mbp (735 bp) score=10
OAN307_c15890 hypothetical protein DUF692 OAN307:1.576..1.577 Mbp (861 bp) score=10
thrS threonyl-tRNA synthetase ThrS OAN307:1.578..1.58 Mbp (1.95 kbp) score=10
OAN307_c15910 hypothetical protein OAN307:1.58..1.58 Mbp (357 bp) score=10
OAN307_c15930 hypothetical protein OAN307:1.581..1.582 Mbp (297 bp) score=10
OAN307_c15940 hypothetical protein OAN307:1.582..1.582 Mbp (321 bp) score=10
OAN307_c15990 putative PHB synthesis repressor protein OAN307:1.587..1.588 Mbp (543 bp) score=10
OAN307_c16010 hypothetical protein OAN307:1.589..1.59 Mbp (1.122 kbp) score=10
OAN307_c16020 putative gamma-glutamylputrescine synthetase OAN307:1.59..1.591 Mbp (1.353 kbp) score=10
OAN307_c16040 putative gamma-glutamylputrescine synthetase OAN307:1.592..1.594 Mbp (1.329 kbp) score=10
OAN307_c16100 hypothetical protein OAN307:1.598..1.598 Mbp (732 bp) score=10
OAN307_c16110 hypothetical protein DUF1332 OAN307:1.599..1.599 Mbp (438 bp) score=10
OAN307_c16130 hypothetical protein DUF519 OAN307:1.6..1.6 Mbp (771 bp) score=10
OAN307_c16160 hypothetical protein OAN307:1.603..1.603 Mbp (399 bp) score=10
purA adenylosuccinate synthetase PurA OAN307:1.603..1.605 Mbp (1.296 kbp) score=10
OAN307_c16180 hypothetical protein OAN307:1.605..1.605 Mbp (231 bp) score=10
OAN307_c16190 hypothetical protein OAN307:1.605..1.607 Mbp (2.283 kbp) score=10
OAN307_c16220 hypothetical protein DUF6 OAN307:1.609..1.61 Mbp (942 bp) score=10
OAN307_c16290 hypothetical protein OAN307:1.618..1.618 Mbp (201 bp) score=10
OAN307_c16300 hypothetical protein OAN307:1.618..1.619 Mbp (672 bp) score=10
OAN307_c16330 hypothetical protein OAN307:1.621..1.622 Mbp (177 bp) score=10
OAN307_c16340 hypothetical protein OAN307:1.622..1.622 Mbp (564 bp) score=10
OAN307_c16350 hypothetical protein OAN307:1.623..1.623 Mbp (324 bp) score=10
OAN307_c16360 hypothetical protein OAN307:1.623..1.624 Mbp (774 bp) score=10
OAN307_c16400 hypothetical protein OAN307:1.628..1.631 Mbp (3.426 kbp) score=10
OAN307_c16410 hypothetical protein DUF541 OAN307:1.631..1.632 Mbp (717 bp) score=10
OAN307_c16430 hypothetical protein OAN307:1.634..1.635 Mbp (1.041 kbp) score=10
OAN307_c16440 hypothetical protein OAN307:1.635..1.636 Mbp (549 bp) score=10
OAN307_c16450 hypothetical protein OAN307:1.636..1.637 Mbp (435 bp) score=10
OAN307_c16470 hypothetical protein OAN307:1.638..1.638 Mbp (189 bp) score=10
OAN307_c16490 hypothetical protein OAN307:1.64..1.64 Mbp (168 bp) score=10
OAN307_c16530 hypothetical protein OAN307:1.642..1.642 Mbp (357 bp) score=10
OAN307_c16540 hypothetical protein OAN307:1.642..1.643 Mbp (606 bp) score=10
OAN307_c16590 hypothetical protein OAN307:1.648..1.648 Mbp (339 bp) score=10
OAN307_c16630 hypothetical protein OAN307:1.653..1.654 Mbp (189 bp) score=10
OAN307_c16670 hypothetical protein OAN307:1.656..1.656 Mbp (174 bp) score=10
OAN307_c16680 hypothetical protein OAN307:1.657..1.657 Mbp (201 bp) score=10
OAN307_c16770 hypothetical protein OAN307:1.669..1.67 Mbp (696 bp) score=10
OAN307_c16780 hypothetical protein; interrupted by frameshift OAN307:1.67..1.671 Mbp (986 bp) score=10
OAN307_c16800 hypothetical protein OAN307:1.672..1.673 Mbp (1.197 kbp) score=10
OAN307_c16810 hypothetical protein OAN307:1.673..1.674 Mbp (969 bp) score=10
OAN307_c16830 hypothetical protein OAN307:1.676..1.676 Mbp (495 bp) score=10
OAN307_c16840 hypothetical protein OAN307:1.676..1.677 Mbp (795 bp) score=10
OAN307_c16850 hypothetical protein OAN307:1.677..1.677 Mbp (207 bp) score=10
OAN307_c16950 hypothetical protein OAN307:1.686..1.687 Mbp (672 bp) score=10
OAN307_c16980 putative ubiquinone biosynthesis hydroxylase OAN307:1.69..1.691 Mbp (1.197 kbp) score=10
OAN307_c17040 hypothetical protein OAN307:1.696..1.697 Mbp (912 bp) score=10
OAN307_c17050 hypothetical protein OAN307:1.697..1.697 Mbp (348 bp) score=10
OAN307_c17060 hypothetical protein OAN307:1.697..1.698 Mbp (516 bp) score=10
OAN307_c17070 hypothetical protein OAN307:1.698..1.698 Mbp (183 bp) score=10
OAN307_c17080 hypothetical protein OAN307:1.698..1.699 Mbp (150 bp) score=10
OAN307_c17100 hypothetical protein OAN307:1.701..1.701 Mbp (276 bp) score=10
OAN307_c17110 hypothetical protein OAN307:1.702..1.702 Mbp (312 bp) score=10
OAN307_c17120 hypothetical protein OAN307:1.702..1.702 Mbp (210 bp) score=10
OAN307_c17170 hypothetical protein OAN307:1.704..1.705 Mbp (357 bp) score=10
OAN307_c17200 hypothetical protein OAN307:1.706..1.707 Mbp (270 bp) score=10
OAN307_c17210 hypothetical protein OAN307:1.707..1.707 Mbp (276 bp) score=10
OAN307_c17220 hypothetical protein OAN307:1.708..1.708 Mbp (324 bp) score=10
OAN307_c17240 hypothetical protein OAN307:1.709..1.709 Mbp (168 bp) score=10
OAN307_c17300 hypothetical protein OAN307:1.713..1.714 Mbp (117 bp) score=10
OAN307_c17310 hypothetical protein OAN307:1.714..1.715 Mbp (708 bp) score=10
OAN307_c17320 hypothetical protein OAN307:1.715..1.715 Mbp (501 bp) score=10
OAN307_c17330 hypothetical protein OAN307:1.715..1.716 Mbp (1.194 kbp) score=10
OAN307_c17340 hypothetical protein OAN307:1.717..1.717 Mbp (255 bp) score=10
OAN307_c17350 hypothetical protein OAN307:1.717..1.717 Mbp (102 bp) score=10
OAN307_c17360 hypothetical protein OAN307:1.717..1.717 Mbp (168 bp) score=10
OAN307_c17370 hypothetical protein OAN307:1.717..1.718 Mbp (486 bp) score=10
OAN307_c17400 hypothetical protein OAN307:1.721..1.722 Mbp (807 bp) score=10
OAN307_c17500 hypothetical protein OAN307:1.733..1.733 Mbp (531 bp) score=10
OAN307_c17530 hypothetical protein OAN307:1.735..1.736 Mbp (216 bp) score=10
OAN307_c17540 hypothetical protein OAN307:1.736..1.736 Mbp (534 bp) score=10
OAN307_c17560 hypothetical protein OAN307:1.738..1.738 Mbp (603 bp) score=10
OAN307_c17570 hypothetical protein OAN307:1.739..1.739 Mbp (354 bp) score=10
OAN307_c17580 hypothetical protein OAN307:1.739..1.739 Mbp (243 bp) score=10
OAN307_c17590 hypothetical protein OAN307:1.739..1.74 Mbp (417 bp) score=10
OAN307_c17600 hypothetical protein OAN307:1.74..1.741 Mbp (942 bp) score=10
OAN307_c17610 hypothetical protein OAN307:1.74..1.741 Mbp (441 bp) score=10
OAN307_c17620 hypothetical protein OAN307:1.741..1.741 Mbp (657 bp) score=10
OAN307_c17640 hypothetical protein OAN307:1.743..1.743 Mbp (210 bp) score=10
OAN307_c17690 hypothetical protein DUF6 OAN307:1.747..1.747 Mbp (918 bp) score=10
OAN307_c17700 hypothetical protein OAN307:1.748..1.748 Mbp (165 bp) score=10
OAN307_c17710 hypothetical protein OAN307:1.748..1.75 Mbp (1.755 kbp) score=10
OAN307_c17720 hypothetical protein OAN307:1.75..1.751 Mbp (1.455 kbp) score=10
OAN307_c17740 hypothetical protein OAN307:1.753..1.754 Mbp (867 bp) score=10
OAN307_c17760 hypothetical protein OAN307:1.755..1.756 Mbp (573 bp) score=10
OAN307_c17790 hypothetical protein OAN307:1.759..1.76 Mbp (1.431 kbp) score=10
OAN307_c17810 hypothetical protein OAN307:1.762..1.763 Mbp (912 bp) score=10
OAN307_c17820 hypothetical protein OAN307:1.763..1.765 Mbp (1.488 kbp) score=10
OAN307_c17830 hypothetical protein OAN307:1.765..1.765 Mbp (387 bp) score=10
OAN307_c17850 hypothetical protein OAN307:1.766..1.766 Mbp (366 bp) score=10
OAN307_c17870 hypothetical protein; transposase(fragment)-like OAN307:1.768..1.769 Mbp (231 bp) score=10
OAN307_c17900 hypothetical protein; transposase(fragment)-like# OAN307:1.77..1.77 Mbp (225 bp) score=10
OAN307_c17960 hypothetical protein OAN307:1.776..1.776 Mbp (579 bp) score=10
OAN307_c17970 hypothetical protein OAN307:1.776..1.777 Mbp (486 bp) score=10
OAN307_c17980 hypothetical protein OAN307:1.777..1.778 Mbp (1.467 kbp) score=10
OAN307_c18060 hypothetical protein; integrase(fragment)-like OAN307:1.784..1.785 Mbp (246 bp) score=10
OAN307_c18070 hypothetical protein OAN307:1.785..1.787 Mbp (1.092 kbp) score=10
OAN307_c18090 hypothetical protein OAN307:1.788..1.788 Mbp (186 bp) score=10
OAN307_c18110 hypothetical protein OAN307:1.79..1.79 Mbp (555 bp) score=10
OAN307_c18120 hypothetical protein OAN307:1.79..1.79 Mbp (168 bp) score=10
OAN307_c18130 hypothetical protein OAN307:1.79..1.791 Mbp (423 bp) score=10
OAN307_c18170 hypothetical protein OAN307:1.795..1.796 Mbp (696 bp) score=10
OAN307_c18180 hypothetical protein OAN307:1.796..1.797 Mbp (504 bp) score=10
OAN307_c18190 hypothetical protein OAN307:1.797..1.798 Mbp (1.194 kbp) score=10
OAN307_c18220 hypothetical protein; conserved, interrupted by frameshift OAN307:1.803..1.804 Mbp (707 bp) score=10
OAN307_c18310 hypothetical protein OAN307:1.811..1.812 Mbp (858 bp) score=10
OAN307_c18330 hypothetical protein OAN307:1.813..1.813 Mbp (297 bp) score=10
OAN307_c18340 hypothetical protein OAN307:1.813..1.814 Mbp (330 bp) score=10
OAN307_c18350 hypothetical protein OAN307:1.814..1.814 Mbp (162 bp) score=10
OAN307_c18360 hypothetical protein OAN307:1.814..1.815 Mbp (330 bp) score=10
OAN307_c18370 hypothetical protein OAN307:1.815..1.816 Mbp (1.212 kbp) score=10
OAN307_c18410 hypothetical protein OAN307:1.821..1.821 Mbp (357 bp) score=10
OAN307_c18420 hypothetical protein OAN307:1.821..1.822 Mbp (720 bp) score=10
OAN307_c18430 hypothetical protein OAN307:1.822..1.823 Mbp (1.242 kbp) score=10
OAN307_c18440 hypothetical protein OAN307:1.823..1.825 Mbp (1.722 kbp) score=10
OAN307_c18450 hypothetical protein OAN307:1.825..1.825 Mbp (525 bp) score=10
OAN307_c18460 hypothetical protein OAN307:1.825..1.827 Mbp (1.143 kbp) score=10
OAN307_c18470 hypothetical protein OAN307:1.827..1.827 Mbp (423 bp) score=10
OAN307_c18520 hypothetical protein; integrase(fragment)-like OAN307:1.832..1.832 Mbp (186 bp) score=10
OAN307_c18540 hypothetical protein OAN307:1.834..1.835 Mbp (597 bp) score=10
OAN307_c18550 hypothetical protein OAN307:1.835..1.835 Mbp (117 bp) score=10
OAN307_c18560 hypothetical protein OAN307:1.835..1.835 Mbp (297 bp) score=10
OAN307_c18570 hypothetical protein OAN307:1.836..1.836 Mbp (513 bp) score=10
OAN307_c18580 hypothetical protein OAN307:1.837..1.837 Mbp (348 bp) score=10
OAN307_c18610 hypothetical protein OAN307:1.84..1.841 Mbp (1.017 kbp) score=10
OAN307_c18620 hypothetical protein OAN307:1.841..1.843 Mbp (1.761 kbp) score=10
OAN307_c18630 hypothetical protein OAN307:1.843..1.844 Mbp (516 bp) score=10
OAN307_c18670 hypothetical protein OAN307:1.846..1.846 Mbp (690 bp) score=10
OAN307_c18720 hypothetical protein OAN307:1.85..1.851 Mbp (1.266 kbp) score=10
OAN307_c18800 hypothetical protein OAN307:1.858..1.859 Mbp (1.527 kbp) score=10
OAN307_c18810 hypothetical protein OAN307:1.859..1.86 Mbp (957 bp) score=10
OAN307_c18850 hypothetical protein OAN307:1.863..1.863 Mbp (546 bp) score=10
OAN307_c18880 hypothetical protein OAN307:1.866..1.867 Mbp (1.467 kbp) score=10
OAN307_c18890 hypothetical protein OAN307:1.867..1.867 Mbp (210 bp) score=10
OAN307_c18900 hypothetical protein OAN307:1.868..1.869 Mbp (1.461 kbp) score=10
OAN307_c18920 hypothetical protein OAN307:1.871..1.873 Mbp (1.935 kbp) score=10
OAN307_c18930 hypothetical protein OAN307:1.873..1.874 Mbp (192 bp) score=10
OAN307_c18960 hypothetical protein OAN307:1.877..1.878 Mbp (633 bp) score=10
OAN307_c18970 hypothetical protein OAN307:1.878..1.878 Mbp (936 bp) score=10
OAN307_c19000 hypothetical protein OAN307:1.881..1.881 Mbp (192 bp) score=10
OAN307_c19030 hypothetical protein OAN307:1.883..1.884 Mbp (729 bp) score=10
OAN307_c19200 hypothetical protein OAN307:1.899..1.899 Mbp (312 bp) score=10
OAN307_c19210 hypothetical protein OAN307:1.9..1.9 Mbp (255 bp) score=10
OAN307_c19240 hypothetical protein OAN307:1.902..1.902 Mbp (222 bp) score=10
OAN307_c19290 hypothetical protein OAN307:1.906..1.907 Mbp (450 bp) score=10
OAN307_c19340 hypothetical protein OAN307:1.912..1.913 Mbp (1.017 kbp) score=10
OAN307_c19350 hypothetical protein OAN307:1.914..1.915 Mbp (1.761 kbp) score=10
OAN307_c19360 hypothetical protein OAN307:1.916..1.916 Mbp (288 bp) score=10
OAN307_c19370 hypothetical protein OAN307:1.916..1.918 Mbp (1.851 kbp) score=10
OAN307_c19390 hypothetical protein OAN307:1.923..1.926 Mbp (3.084 kbp) score=10
OAN307_c19410 hypothetical protein OAN307:1.931..1.937 Mbp (6.018 kbp) score=10
OAN307_c19460 hypothetical protein OAN307:1.943..1.944 Mbp (192 bp) score=10
OAN307_c19510 hypothetical protein OAN307:1.949..1.95 Mbp (1.017 kbp) score=10
OAN307_c19520 hypothetical protein OAN307:1.95..1.952 Mbp (1.761 kbp) score=10
OAN307_c19550 hypothetical protein OAN307:1.956..1.956 Mbp (216 bp) score=10
OAN307_c19590 hypothetical protein OAN307:1.958..1.959 Mbp (498 bp) score=10
OAN307_c19620 hypothetical protein OAN307:1.962..1.962 Mbp (252 bp) score=10
OAN307_c19640 hypothetical protein OAN307:1.963..1.963 Mbp (294 bp) score=10
OAN307_c19670 hypothetical protein OAN307:1.964..1.965 Mbp (150 bp) score=10
OAN307_c19680 hypothetical protein OAN307:1.965..1.967 Mbp (1.884 kbp) score=10
OAN307_c19760 hypothetical protein OAN307:1.973..1.973 Mbp (312 bp) score=10
OAN307_c19800 hypothetical protein OAN307:1.978..1.979 Mbp (705 bp) score=10
OAN307_c19820 hypothetical protein OAN307:1.979..1.98 Mbp (1.464 kbp) score=10
OAN307_c19840 hypothetical protein OAN307:1.982..1.982 Mbp (279 bp) score=10
OAN307_c19930 hypothetical protein OAN307:1.992..1.992 Mbp (171 bp) score=10
OAN307_c19980 hypothetical protein OAN307:1.996..1.997 Mbp (606 bp) score=10
OAN307_c19990 hypothetical protein OAN307:1.997..1.997 Mbp (507 bp) score=10
OAN307_c20160 hypothetical protein OAN307:2.015..2.016 Mbp (921 bp) score=10
OAN307_c20190 AMP-dependent synthetase / ligase OAN307:2.019..2.021 Mbp (1.908 kbp) score=10
OAN307_c20250 hypothetical protein OAN307:2.024..2.024 Mbp (198 bp) score=10
OAN307_c20260 hypothetical protein OAN307:2.024..2.024 Mbp (216 bp) score=10
OAN307_c20300 hypothetical protein DUF1537 OAN307:2.028..2.029 Mbp (1.272 kbp) score=10
OAN307_c20310 hypothetical protein OAN307:2.029..2.03 Mbp (909 bp) score=10
OAN307_c20350 hypothetical protein OAN307:2.034..2.034 Mbp (195 bp) score=10
OAN307_c20370 hypothetical protein OAN307:2.036..2.036 Mbp (261 bp) score=10
OAN307_c20380 hypothetical protein OAN307:2.036..2.036 Mbp (249 bp) score=10
OAN307_c20400 hypothetical protein; transposase(fragment)-like OAN307:2.038..2.039 Mbp (1.098 kbp) score=10
OAN307_c20480 hypothetical protein OAN307:2.049..2.049 Mbp (405 bp) score=10
OAN307_c20490 hypothetical protein; metallopeptidase-like, interrupted by pointmutation OAN307:2.049..2.05 Mbp (1.434 kbp) score=10
OAN307_c20500 hypothetical protein OAN307:2.051..2.051 Mbp (756 bp) score=10
glnA glutamine synthetase GlnA OAN307:2.052..2.053 Mbp (1.263 kbp) score=10
OAN307_c20530 hypothetical protein OAN307:2.054..2.054 Mbp (234 bp) score=10
OAN307_c20550 hypothetical protein OAN307:2.055..2.055 Mbp (651 bp) score=10
OAN307_c20600 hypothetical protein; transposase(fragment)-like OAN307:2.058..2.058 Mbp (162 bp) score=10
OAN307_c20610 hypothetical protein OAN307:2.059..2.059 Mbp (453 bp) score=10
OAN307_c20640 hypothetical protein; NagA N-terminal fragment-like OAN307:2.063..2.063 Mbp (240 bp) score=10
OAN307_c20650 hypothetical protein OAN307:2.063..2.064 Mbp (744 bp) score=10
OAN307_c20780 hypothetical protein OAN307:2.078..2.079 Mbp (645 bp) score=10
OAN307_c20840 hypothetical protein OAN307:2.085..2.086 Mbp (690 bp) score=10
OAN307_c20860 hypothetical protein OAN307:2.087..2.087 Mbp (390 bp) score=10
OAN307_c20870 hypothetical protein OAN307:2.088..2.088 Mbp (537 bp) score=10
OAN307_c20910 hypothetical protein OAN307:2.091..2.091 Mbp (459 bp) score=10
OAN307_c20980 hypothetical protein OAN307:2.096..2.096 Mbp (177 bp) score=10
OAN307_c21000 hypothetical protein OAN307:2.098..2.098 Mbp (264 bp) score=10
OAN307_c21010 hypothetical protein OAN307:2.098..2.098 Mbp (294 bp) score=10
OAN307_c21030 hypothetical protein OAN307:2.1..2.1 Mbp (690 bp) score=10
OAN307_c21040 hypothetical protein OAN307:2.1..2.101 Mbp (219 bp) score=10
OAN307_c21060 hypothetical protein OAN307:2.102..2.103 Mbp (456 bp) score=10
OAN307_c21070 hypothetical protein OAN307:2.103..2.103 Mbp (402 bp) score=10
OAN307_c21090 hypothetical protein OAN307:2.106..2.106 Mbp (378 bp) score=10
OAN307_c21120 hypothetical protein OAN307:2.107..2.108 Mbp (441 bp) score=10
coaX type III pantothenate kinase CoaX OAN307:2.115..2.116 Mbp (777 bp) score=10
OAN307_c21220 hypothetical protein OAN307:2.119..2.12 Mbp (597 bp) score=10
OAN307_c21230 hypothetical protein OAN307:2.12..2.12 Mbp (441 bp) score=10
OAN307_c21250 hypothetical protein OAN307:2.122..2.123 Mbp (984 bp) score=10
OAN307_c21320 hypothetical protein DUF815 OAN307:2.128..2.128 Mbp (837 bp) score=10
OAN307_c21370 hypothetical protein OAN307:2.132..2.132 Mbp (258 bp) score=10
OAN307_c21390 hypothetical protein OAN307:2.134..2.134 Mbp (288 bp) score=10
OAN307_c21420 hypothetical protein OAN307:2.136..2.137 Mbp (411 bp) score=10
OAN307_c21430 hypothetical protein OAN307:2.137..2.138 Mbp (759 bp) score=10
OAN307_c21450 hypothetical protein DUF14 OAN307:2.139..2.14 Mbp (777 bp) score=10
alr biosynthetic OAN307:2.14..2.141 Mbp (1.038 kbp) score=10
OAN307_c21500 hypothetical protein OAN307:2.145..2.145 Mbp (282 bp) score=10
OAN307_c21510 hypothetical protein OAN307:2.145..2.146 Mbp (954 bp) score=10
OAN307_c21530 hypothetical protein OAN307:2.147..2.148 Mbp (234 bp) score=10
OAN307_c21550 hypothetical protein OAN307:2.15..2.151 Mbp (894 bp) score=10
OAN307_c21580 hypothetical protein DUF2133 OAN307:2.156..2.156 Mbp (690 bp) score=10
OAN307_c21610 hypothetical protein OAN307:2.159..2.16 Mbp (708 bp) score=10
OAN307_c21620 hypothetical protein DUF2235 OAN307:2.16..2.161 Mbp (1.278 kbp) score=10
serS seryl-tRNA synthetase SerS OAN307:2.161..2.163 Mbp (1.293 kbp) score=10
OAN307_c21650 hypothetical protein OAN307:2.163..2.164 Mbp (390 bp) score=10
OAN307_c21740 hypothetical protein OAN307:2.173..2.174 Mbp (705 bp) score=10
OAN307_c21760 hypothetical protein OAN307:2.175..2.175 Mbp (270 bp) score=10
luxI N-acyl-L-homoserine lactone synthetase-likeprotein LuxI OAN307:2.178..2.179 Mbp (627 bp) score=10
OAN307_c21830 hypothetical protein OAN307:2.18..2.181 Mbp (414 bp) score=10
OAN307_c21850 hypothetical protein OAN307:2.182..2.183 Mbp (1.425 kbp) score=10
OAN307_c21860 hypothetical protein OAN307:2.184..2.185 Mbp (390 bp) score=10
OAN307_c21900 hypothetical protein; transposase(fragment)-like OAN307:2.186..2.187 Mbp (615 bp) score=10
OAN307_c21910 hypothetical protein OAN307:2.187..2.187 Mbp (387 bp) score=10
OAN307_c21920 hypothetical protein; transposase(fragment)-like OAN307:2.187..2.188 Mbp (576 bp) score=10
OAN307_c21940 hypothetical protein OAN307:2.189..2.193 Mbp (3.414 kbp) score=10
OAN307_c21990 hypothetical protein OAN307:2.196..2.196 Mbp (576 bp) score=10
OAN307_c22030 hypothetical protein OAN307:2.2..2.2 Mbp (486 bp) score=10
gltX2 glutamyl-tRNA synthetase OAN307:2.202..2.204 Mbp (1.434 kbp) score=10
moeA molybdopterin biosynthesis protein MoeA OAN307:2.207..2.208 Mbp (1.191 kbp) score=10
moaC molybdenum cofactor biosynthesis protein MoaC OAN307:2.208..2.208 Mbp (477 bp) score=10
OAN307_c22140 hypothetical protein OAN307:2.211..2.213 Mbp (1.503 kbp) score=10
OAN307_c22160 hypothetical protein OAN307:2.214..2.216 Mbp (1.845 kbp) score=10
OAN307_c22220 hypothetical protein DUF192 OAN307:2.221..2.221 Mbp (486 bp) score=10
OAN307_c22240 hypothetical protein OAN307:2.222..2.222 Mbp (399 bp) score=10
OAN307_c22310 hypothetical protein OAN307:2.228..2.228 Mbp (192 bp) score=10
OAN307_c22320 hypothetical protein OAN307:2.228..2.228 Mbp (462 bp) score=10
OAN307_c22340 hypothetical protein OAN307:2.233..2.233 Mbp (231 bp) score=10
OAN307_c22350 hypothetical protein OAN307:2.233..2.234 Mbp (165 bp) score=10
OAN307_c22360 hypothetical protein OAN307:2.234..2.234 Mbp (663 bp) score=10
OAN307_c22370 hypothetical protein OAN307:2.234..2.234 Mbp (135 bp) score=10
OAN307_c22470 hypothetical protein OAN307:2.246..2.247 Mbp (702 bp) score=10
OAN307_c22490 hypothetical protein OAN307:2.247..2.248 Mbp (876 bp) score=10
tyrS tyrosyl-tRNA synthetase TyrS OAN307:2.248..2.25 Mbp (1.542 kbp) score=10
OAN307_c22530 hypothetical protein OAN307:2.252..2.253 Mbp (339 bp) score=10
OAN307_c22540 hypothetical protein OAN307:2.253..2.253 Mbp (297 bp) score=10
OAN307_c22550 hypothetical protein OAN307:2.253..2.253 Mbp (603 bp) score=10
OAN307_c22560 hypothetical protein OAN307:2.254..2.254 Mbp (813 bp) score=10
cysS cysteinyl-tRNA synthetase CysS OAN307:2.257..2.259 Mbp (1.446 kbp) score=10
OAN307_c22610 alpha-IPM synthetase/homocitrate synthase OAN307:2.259..2.26 Mbp (1.638 kbp) score=10
OAN307_c22620 hypothetical protein OAN307:2.26..2.261 Mbp (726 bp) score=10
cbiD cobalamin [vitamin B12] biosynthesis protein CbiD OAN307:2.265..2.266 Mbp (1.065 kbp) score=10
OAN307_c22700 hypothetical protein OAN307:2.268..2.269 Mbp (615 bp) score=10
OAN307_c22740 hypothetical protein OAN307:2.273..2.273 Mbp (573 bp) score=10
OAN307_c22760 hypothetical protein OAN307:2.274..2.274 Mbp (174 bp) score=10
thi5 putative thiamine biosynthesis protein Thi5 OAN307:2.277..2.278 Mbp (948 bp) score=10
thiF putative thiamine biosynthesis protein ThiF OAN307:2.278..2.279 Mbp (963 bp) score=10
thiG thiazole biosynthesis protein ThiG OAN307:2.28..2.28 Mbp (762 bp) score=10
thiS thiamine biosynthesis protein thiS OAN307:2.28..2.281 Mbp (198 bp) score=10
thiO putative thiamine biosynthesis protein ThiO OAN307:2.281..2.282 Mbp (981 bp) score=10
OAN307_c22890 hypothetical protein OAN307:2.285..2.285 Mbp (387 bp) score=10
OAN307_c22910 hypothetical protein OAN307:2.286..2.288 Mbp (1.2 kbp) score=10
OAN307_c22940 hypothetical protein DUF1185 OAN307:2.289..2.289 Mbp (585 bp) score=10
OAN307_c22950 hypothetical protein DUF1185 OAN307:2.289..2.29 Mbp (582 bp) score=10
OAN307_c22970 hypothetical protein OAN307:2.291..2.292 Mbp (1.491 kbp) score=10
OAN307_c23070 hypothetical protein OAN307:2.304..2.305 Mbp (315 bp) score=10
OAN307_c23110 hypothetical protein OAN307:2.308..2.308 Mbp (201 bp) score=10
OAN307_c23120 hypothetical protein OAN307:2.309..2.31 Mbp (1.578 kbp) score=10
OAN307_c23150 hypothetical protein OAN307:2.313..2.313 Mbp (243 bp) score=10
OAN307_c23160 hypothetical protein OAN307:2.313..2.315 Mbp (2.028 kbp) score=10
OAN307_c23180 hypothetical protein OAN307:2.317..2.318 Mbp (1.119 kbp) score=10
OAN307_c23290 hypothetical protein DUF85 OAN307:2.332..2.332 Mbp (594 bp) score=10
OAN307_c23310 hypothetical protein OAN307:2.334..2.334 Mbp (210 bp) score=10
OAN307_c23390 hypothetical protein; ABC transporter solute binding protein fragment-like OAN307:2.342..2.342 Mbp (201 bp) score=10
OAN307_c23400 hypothetical protein; ABC transporter ATP-binding protein fragment-like OAN307:2.343..2.344 Mbp (1.076 kbp) score=10
OAN307_c23410 hypothetical protein OAN307:2.344..2.344 Mbp (255 bp) score=10
OAN307_c23430 hypothetical protein OAN307:2.346..2.347 Mbp (1.116 kbp) score=10
OAN307_c23440 hypothetical protein OAN307:2.349..2.349 Mbp (267 bp) score=10
OAN307_c23450 hypothetical protein OAN307:2.349..2.35 Mbp (474 bp) score=10
OAN307_c23470 hypothetical protein; similar to animal haem peroxidase OAN307:2.353..2.355 Mbp (2.615 kbp) score=10
OAN307_c23480 hypothetical protein OAN307:2.355..2.356 Mbp (570 bp) score=10
OAN307_c23490 hypothetical protein OAN307:2.356..2.358 Mbp (1.626 kbp) score=10
OAN307_c23540 hypothetical protein DUF853 OAN307:2.362..2.363 Mbp (1.488 kbp) score=10
OAN307_c23570 hypothetical protein OAN307:2.366..2.368 Mbp (1.842 kbp) score=10
uppS undecaprenyl pyrophosphate synthetase UppS OAN307:2.381..2.382 Mbp (720 bp) score=10
OAN307_c23820 hypothetical protein OAN307:2.394..2.394 Mbp (297 bp) score=10
OAN307_c23830 hypothetical protein OAN307:2.394..2.395 Mbp (927 bp) score=10
OAN307_c23870 hypothetical protein OAN307:2.398..2.398 Mbp (279 bp) score=10
OAN307_c23910 hypothetical protein OAN307:2.404..2.404 Mbp (453 bp) score=10
OAN307_c23930 putative glutamyl-Q tRNA synthetase OAN307:2.405..2.406 Mbp (861 bp) score=10
OAN307_c23990 hypothetical protein OAN307:2.413..2.413 Mbp (558 bp) score=10
OAN307_c24000 hypothetical protein OAN307:2.413..2.414 Mbp (579 bp) score=10
OAN307_c24010 hypothetical protein OAN307:2.414..2.414 Mbp (267 bp) score=10
OAN307_c24030 hypothetical protein OAN307:2.415..2.415 Mbp (567 bp) score=10
OAN307_c24040 hypothetical protein OAN307:2.416..2.416 Mbp (576 bp) score=10
OAN307_c24070 hypothetical protein OAN307:2.421..2.422 Mbp (558 bp) score=10
OAN307_c24090 hypothetical protein OAN307:2.423..2.424 Mbp (489 bp) score=10
OAN307_c24140 hypothetical protein OAN307:2.431..2.431 Mbp (228 bp) score=10
OAN307_c24170 hypothetical protein OAN307:2.432..2.433 Mbp (456 bp) score=10
OAN307_c24200 hypothetical protein OAN307:2.436..2.437 Mbp (1.023 kbp) score=10
OAN307_c24210 hypothetical protein DUF52 OAN307:2.437..2.437 Mbp (792 bp) score=10
OAN307_c24230 hypothetical protein OAN307:2.438..2.439 Mbp (888 bp) score=10
OAN307_c24250 hypothetical protein OAN307:2.441..2.442 Mbp (678 bp) score=10
OAN307_c24260 hypothetical protein OAN307:2.442..2.442 Mbp (471 bp) score=10
OAN307_c24300 hypothetical protein OAN307:2.444..2.444 Mbp (351 bp) score=10
OAN307_c24380 hypothetical protein OAN307:2.452..2.452 Mbp (204 bp) score=10
OAN307_c24390 hypothetical protein OAN307:2.453..2.454 Mbp (1.353 kbp) score=10
OAN307_c24400 hypothetical protein OAN307:2.455..2.456 Mbp (816 bp) score=10
OAN307_c24410 hypothetical protein OAN307:2.456..2.457 Mbp (1.362 kbp) score=10
OAN307_c24470 hypothetical protein OAN307:2.464..2.465 Mbp (609 bp) score=10
OAN307_c24700 hypothetical protein OAN307:2.489..2.49 Mbp (927 bp) score=10
OAN307_c24710 hypothetical protein; transposase(fragment)-like OAN307:2.49..2.49 Mbp (276 bp) score=10
OAN307_c24800 putative glutamine synthetase OAN307:2.499..2.501 Mbp (1.365 kbp) score=10
OAN307_c24860 hypothetical protein OAN307:2.506..2.506 Mbp (186 bp) score=10
OAN307_c24900 hypothetical protein OAN307:2.511..2.511 Mbp (759 bp) score=10
OAN307_c24930 hypothetical protein OAN307:2.514..2.514 Mbp (426 bp) score=10
OAN307_c24940 hypothetical protein OAN307:2.514..2.515 Mbp (366 bp) score=10
OAN307_c24950 hypothetical protein OAN307:2.515..2.515 Mbp (501 bp) score=10
OAN307_c25110 hypothetical protein OAN307:2.534..2.535 Mbp (210 bp) score=10
OAN307_c25130 hypothetical protein OAN307:2.536..2.536 Mbp (447 bp) score=10
OAN307_c25150 hypothetical protein OAN307:2.537..2.537 Mbp (129 bp) score=10
OAN307_c25170 hypothetical protein OAN307:2.539..2.54 Mbp (1.044 kbp) score=10
OAN307_c25190 hypothetical protein OAN307:2.541..2.542 Mbp (522 bp) score=10
OAN307_c25220 hypothetical protein OAN307:2.545..2.546 Mbp (675 bp) score=10
OAN307_c25240 hypothetical protein OAN307:2.547..2.548 Mbp (618 bp) score=10
OAN307_c25260 hypothetical protein OAN307:2.549..2.55 Mbp (1.104 kbp) score=10
OAN307_c25270 hypothetical protein OAN307:2.55..2.551 Mbp (864 bp) score=10
OAN307_c25290 hypothetical protein OAN307:2.552..2.553 Mbp (1.002 kbp) score=10
OAN307_c25320 hypothetical protein OAN307:2.555..2.555 Mbp (150 bp) score=10
OAN307_c25460 hypothetical protein OAN307:2.565..2.565 Mbp (372 bp) score=10
OAN307_c25480 hypothetical protein OAN307:2.566..2.567 Mbp (876 bp) score=10
OAN307_c25490 hypothetical protein OAN307:2.567..2.568 Mbp (312 bp) score=10
OAN307_c25520 hypothetical protein OAN307:2.57..2.57 Mbp (195 bp) score=10
OAN307_c25560 hypothetical protein OAN307:2.573..2.574 Mbp (468 bp) score=10
OAN307_c25570 hypothetical protein OAN307:2.574..2.574 Mbp (354 bp) score=10
OAN307_c25580 hypothetical protein OAN307:2.575..2.575 Mbp (330 bp) score=10
OAN307_c25590 hypothetical protein OAN307:2.575..2.576 Mbp (300 bp) score=10
OAN307_c25600 hypothetical protein OAN307:2.576..2.576 Mbp (156 bp) score=10
OAN307_c25640 hypothetical protein OAN307:2.579..2.579 Mbp (234 bp) score=10
OAN307_c25660 hypothetical protein OAN307:2.58..2.581 Mbp (165 bp) score=10
OAN307_c25670 hypothetical protein OAN307:2.581..2.581 Mbp (150 bp) score=10
OAN307_c25690 hypothetical protein OAN307:2.582..2.582 Mbp (567 bp) score=10
OAN307_c25810 hypothetical protein OAN307:2.594..2.594 Mbp (363 bp) score=10
OAN307_c25820 hypothetical protein OAN307:2.594..2.595 Mbp (300 bp) score=10
OAN307_c25830 hypothetical protein OAN307:2.595..2.595 Mbp (270 bp) score=10
OAN307_c25840 hypothetical protein OAN307:2.597..2.597 Mbp (267 bp) score=10
OAN307_c25900 hypothetical protein OAN307:2.602..2.603 Mbp (1.011 kbp) score=10
OAN307_c25970 hypothetical protein OAN307:2.608..2.609 Mbp (507 bp) score=10
OAN307_c26070 hypothetical protein OAN307:2.616..2.617 Mbp (582 bp) score=10
OAN307_c26120 hypothetical protein OAN307:2.62..2.62 Mbp (351 bp) score=10
OAN307_c26130 thermostable carboxypeptidase 1 OAN307:2.62..2.622 Mbp (1.47 kbp) score=10
OAN307_c26180 hypothetical protein OAN307:2.625..2.626 Mbp (792 bp) score=10
OAN307_c26190 hypothetical protein OAN307:2.626..2.626 Mbp (150 bp) score=10
OAN307_c26200 hypothetical protein; conserved, interrupted by pointmutation OAN307:2.626..2.627 Mbp (588 bp) score=10
OAN307_c26260 hypothetical protein OAN307:2.631..2.631 Mbp (621 bp) score=10
OAN307_c26290 hypothetical protein OAN307:2.633..2.634 Mbp (822 bp) score=10
OAN307_c26310 hypothetical protein OAN307:2.634..2.635 Mbp (573 bp) score=10
OAN307_c26320 hypothetical protein OAN307:2.635..2.636 Mbp (1.245 kbp) score=10
OAN307_c26330 hypothetical protein OAN307:2.636..2.637 Mbp (765 bp) score=10
OAN307_c26360 hypothetical protein OAN307:2.642..2.643 Mbp (753 bp) score=10
OAN307_c26390 hypothetical protein OAN307:2.647..2.648 Mbp (210 bp) score=10
OAN307_c26400 hypothetical protein OAN307:2.648..2.648 Mbp (507 bp) score=10
OAN307_c26410 hypothetical protein OAN307:2.649..2.65 Mbp (1.23 kbp) score=10
OAN307_c26430 hypothetical protein OAN307:2.652..2.653 Mbp (1.254 kbp) score=10
OAN307_c26440 hypothetical protein OAN307:2.653..2.653 Mbp (510 bp) score=10
OAN307_c26450 hypothetical protein OAN307:2.654..2.655 Mbp (972 bp) score=10
OAN307_c26480 hypothetical protein; integrase(fragment)-like OAN307:2.658..2.658 Mbp (246 bp) score=10
OAN307_c26500 hypothetical protein OAN307:2.658..2.659 Mbp (795 bp) score=10
OAN307_c26510 hypothetical protein OAN307:2.66..2.66 Mbp (159 bp) score=10
OAN307_c26520 hypothetical protein OAN307:2.66..2.661 Mbp (825 bp) score=10
OAN307_c26580 hypothetical protein OAN307:2.666..2.667 Mbp (1.425 kbp) score=10
OAN307_c26630 hypothetical protein; integrase(fragment)-like OAN307:2.67..2.671 Mbp (315 bp) score=10
OAN307_c26650 hypothetical protein DUF897 OAN307:2.672..2.673 Mbp (1.092 kbp) score=10
OAN307_c26660 hypothetical protein; transposase(fragment)-like OAN307:2.673..2.673 Mbp (334 bp) score=10
OAN307_c26670 hypothetical protein OAN307:2.674..2.675 Mbp (1.26 kbp) score=10
OAN307_c26700 hypothetical protein OAN307:2.677..2.677 Mbp (177 bp) score=10
OAN307_c26720 hypothetical protein DUF145 OAN307:2.679..2.679 Mbp (675 bp) score=10
OAN307_c26810 hypothetical protein OAN307:2.685..2.686 Mbp (642 bp) score=10
OAN307_c26860 hypothetical protein; transposase(fragment)-like OAN307:2.69..2.69 Mbp (189 bp) score=10
OAN307_c26870 hypothetical protein; transposase(fragment)-like OAN307:2.691..2.691 Mbp (585 bp) score=10
OAN307_c26880 hypothetical protein; transposase(fragment)-like OAN307:2.691..2.692 Mbp (544 bp) score=10
OAN307_c26900 hypothetical protein OAN307:2.692..2.693 Mbp (516 bp) score=10
OAN307_c26910 hypothetical protein OAN307:2.693..2.694 Mbp (552 bp) score=10
OAN307_c26980 hypothetical protein OAN307:2.701..2.701 Mbp (330 bp) score=10
OAN307_c26990 hypothetical protein OAN307:2.701..2.702 Mbp (183 bp) score=10
OAN307_c27000 hypothetical protein OAN307:2.702..2.702 Mbp (573 bp) score=10
OAN307_c27030 hypothetical protein OAN307:2.706..2.707 Mbp (732 bp) score=10
OAN307_c27050 hypothetical protein DUF43 OAN307:2.707..2.708 Mbp (942 bp) score=10
OAN307_c27060 hypothetical protein DUF44/DUF47 OAN307:2.708..2.71 Mbp (1.473 kbp) score=10
OAN307_c27070 hypothetical protein OAN307:2.71..2.71 Mbp (213 bp) score=10
OAN307_c27080 hypothetical protein OAN307:2.711..2.711 Mbp (327 bp) score=10
OAN307_c27090 hypothetical protein OAN307:2.711..2.712 Mbp (468 bp) score=10
OAN307_c27100 hypothetical protein DUF6 OAN307:2.712..2.713 Mbp (894 bp) score=10
OAN307_c27140 hypothetical protein OAN307:2.716..2.716 Mbp (561 bp) score=10
OAN307_c27230 hypothetical protein OAN307:2.726..2.727 Mbp (717 bp) score=10
OAN307_c27260 hypothetical protein OAN307:2.729..2.729 Mbp (459 bp) score=10
OAN307_c27320 hypothetical protein OAN307:2.735..2.736 Mbp (894 bp) score=10
OAN307_c27330 hypothetical protein OAN307:2.736..2.737 Mbp (603 bp) score=10
OAN307_c27340 hypothetical protein OAN307:2.737..2.737 Mbp (627 bp) score=10
plsX fatty acid/phospholipid synthesis protein PlsX OAN307:2.738..2.739 Mbp (1.131 kbp) score=10
OAN307_c27410 hypothetical protein OAN307:2.742..2.742 Mbp (198 bp) score=10
OAN307_c27430 hypothetical protein OAN307:2.743..2.744 Mbp (780 bp) score=10
OAN307_c27450 hypothetical protein OAN307:2.745..2.746 Mbp (1.044 kbp) score=10
OAN307_c27460 arginyl-tRNA synthetase OAN307:2.746..2.748 Mbp (1.737 kbp) score=10
OAN307_c27470 hypothetical protein OAN307:2.748..2.748 Mbp (243 bp) score=10
OAN307_c27530 hypothetical protein OAN307:2.752..2.753 Mbp (840 bp) score=10
OAN307_c27540 hypothetical protein OAN307:2.754..2.755 Mbp (1.386 kbp) score=10
OAN307_c27550 hypothetical protein OAN307:2.756..2.757 Mbp (1.185 kbp) score=10
OAN307_c27560 hypothetical protein OAN307:2.757..2.757 Mbp (360 bp) score=10
OAN307_c27570 hypothetical protein OAN307:2.757..2.758 Mbp (675 bp) score=10
OAN307_c27600 hypothetical protein OAN307:2.76..2.76 Mbp (540 bp) score=10
OAN307_c27620 hypothetical protein OAN307:2.762..2.762 Mbp (462 bp) score=10
OAN307_c27660 hypothetical protein OAN307:2.768..2.768 Mbp (471 bp) score=10
OAN307_c27670 hypothetical protein OAN307:2.769..2.769 Mbp (468 bp) score=10
OAN307_c27690 hypothetical protein OAN307:2.77..2.77 Mbp (666 bp) score=10
OAN307_c27740 hypothetical protein OAN307:2.777..2.777 Mbp (309 bp) score=10
OAN307_c27750 hypothetical protein OAN307:2.777..2.778 Mbp (1.356 kbp) score=10
OAN307_c27760 hypothetical protein OAN307:2.779..2.779 Mbp (261 bp) score=10
OAN307_c27800 hypothetical protein OAN307:2.784..2.784 Mbp (258 bp) score=10
OAN307_c27830 hypothetical protein OAN307:2.787..2.787 Mbp (543 bp) score=10
OAN307_c27840 hypothetical protein OAN307:2.788..2.788 Mbp (450 bp) score=10
OAN307_c27860 hypothetical protein OAN307:2.79..2.791 Mbp (972 bp) score=10
OAN307_c27910 hypothetical protein OAN307:2.794..2.795 Mbp (297 bp) score=10
OAN307_c28020 hypothetical protein OAN307:2.807..2.807 Mbp (228 bp) score=10
OAN307_c28160 hypothetical protein OAN307:2.817..2.817 Mbp (342 bp) score=10
OAN307_c28200 hypothetical protein OAN307:2.82..2.82 Mbp (309 bp) score=10
OAN307_c28240 hypothetical protein; transposase(fragment)-like OAN307:2.824..2.825 Mbp (447 bp) score=10
OAN307_c28250 hypothetical protein; transposase(fragment)-like OAN307:2.825..2.825 Mbp (252 bp) score=10
OAN307_c28300 hypothetical protein; transposase(fragment)-like OAN307:2.83..2.831 Mbp (1.482 kbp) score=10
OAN307_c28310 hypothetical protein OAN307:2.831..2.832 Mbp (417 bp) score=10
OAN307_c28330 hypothetical protein; transposase(fragment)-like OAN307:2.833..2.834 Mbp (505 bp) score=10
OAN307_c28340 hypothetical protein; transposase(fragment)-like OAN307:2.834..2.834 Mbp (213 bp) score=10
OAN307_c28360 hypothetical protein OAN307:2.837..2.837 Mbp (237 bp) score=10
OAN307_c28390 hypothetical protein OAN307:2.838..2.838 Mbp (531 bp) score=10
OAN307_c28410 hypothetical protein OAN307:2.841..2.841 Mbp (627 bp) score=10
OAN307_c28420 hypothetical protein DUF88 OAN307:2.842..2.842 Mbp (957 bp) score=10
OAN307_c28440 hypothetical protein OAN307:2.844..2.844 Mbp (570 bp) score=10
coaD phosphopantetheine adenylyltransferase CoaD OAN307:2.846..2.847 Mbp (495 bp) score=10
OAN307_c28470 hypothetical protein OAN307:2.847..2.847 Mbp (438 bp) score=10
OAN307_c28500 hypothetical protein OAN307:2.85..2.85 Mbp (240 bp) score=10
OAN307_c28600 hypothetical protein OAN307:2.861..2.862 Mbp (387 bp) score=10
OAN307_c28610 hypothetical protein OAN307:2.862..2.862 Mbp (219 bp) score=10
OAN307_c28620 hypothetical protein DUF924 OAN307:2.862..2.863 Mbp (606 bp) score=10
OAN307_c28650 hypothetical protein OAN307:2.865..2.869 Mbp (3.312 kbp) score=10
OAN307_c28690 hypothetical protein DUF583 OAN307:2.872..2.873 Mbp (519 bp) score=10
OAN307_c28700 hypothetical protein OAN307:2.873..2.874 Mbp (780 bp) score=10
OAN307_c28790 hypothetical protein OAN307:2.884..2.886 Mbp (1.227 kbp) score=10
OAN307_c28810 hypothetical protein OAN307:2.887..2.888 Mbp (195 bp) score=10
OAN307_c28840 hypothetical protein OAN307:2.89..2.891 Mbp (279 bp) score=10
OAN307_c28850 hypothetical protein OAN307:2.891..2.892 Mbp (720 bp) score=10
OAN307_c28930 hypothetical protein OAN307:2.898..2.898 Mbp (342 bp) score=10
OAN307_c28940 hypothetical protein OAN307:2.898..2.898 Mbp (189 bp) score=10
OAN307_c28950 hypothetical protein OAN307:2.899..2.899 Mbp (510 bp) score=10
OAN307_c28970 hypothetical protein; integrase(fragment)-like OAN307:2.9..2.901 Mbp (459 bp) score=10
OAN307_c29060 hypothetical protein OAN307:2.908..2.908 Mbp (567 bp) score=10
OAN307_c29070 hypothetical protein; transposase(fragment)-like# OAN307:2.908..2.908 Mbp (258 bp) score=10
OAN307_c29080 hypothetical protein; transposase(fragment)-like# OAN307:2.909..2.909 Mbp (198 bp) score=10
OAN307_c29120 hypothetical protein OAN307:2.911..2.912 Mbp (639 bp) score=10
OAN307_c29130 hypothetical protein UPF262 OAN307:2.912..2.912 Mbp (480 bp) score=10
OAN307_c29150 hypothetical protein OAN307:2.913..2.914 Mbp (489 bp) score=10
OAN307_c29190 hypothetical protein OAN307:2.916..2.916 Mbp (273 bp) score=10
OAN307_c29290 hypothetical protein OAN307:2.923..2.924 Mbp (420 bp) score=10
OAN307_c29310 hypothetical protein OAN307:2.925..2.926 Mbp (1.26 kbp) score=10
OAN307_c29340 hypothetical protein OAN307:2.929..2.929 Mbp (828 bp) score=10
OAN307_c29400 hypothetical protein OAN307:2.934..2.935 Mbp (903 bp) score=10
OAN307_c29430 hypothetical protein OAN307:2.937..2.938 Mbp (1.167 kbp) score=10
OAN307_c29440 hypothetical protein OAN307:2.939..2.939 Mbp (267 bp) score=10
OAN307_c29450 hypothetical protein OAN307:2.939..2.94 Mbp (762 bp) score=10
OAN307_c29460 hypothetical protein OAN307:2.94..2.94 Mbp (801 bp) score=10
OAN307_c29470 hypothetical protein OAN307:2.94..2.941 Mbp (270 bp) score=10
OAN307_c29480 associated with flagellum synthesis OAN307:2.941..2.942 Mbp (1.149 kbp) score=10
fliR flagellar biosynthetic protein FliR OAN307:2.942..2.943 Mbp (828 bp) score=10
fliQ flagellar biosynthetic protein FliQ OAN307:2.943..2.943 Mbp (267 bp) score=10
fliP flagellar biosynthetic protein FliP OAN307:2.943..2.944 Mbp (777 bp) score=10
OAN307_c29590 hypothetical protein OAN307:2.95..2.951 Mbp (894 bp) score=10
OAN307_c29650 hypothetical protein OAN307:2.957..2.958 Mbp (402 bp) score=10
OAN307_c29670 hypothetical protein OAN307:2.959..2.959 Mbp (789 bp) score=10
OAN307_c29690 hypothetical protein OAN307:2.961..2.962 Mbp (663 bp) score=10
OAN307_c29700 hypothetical protein OAN307:2.962..2.962 Mbp (402 bp) score=10
OAN307_c29710 hypothetical protein OAN307:2.962..2.962 Mbp (270 bp) score=10
OAN307_c29740 hypothetical protein OAN307:2.964..2.964 Mbp (348 bp) score=10
OAN307_c29750 hypothetical protein OAN307:2.964..2.965 Mbp (1.158 kbp) score=10
flhA flagellar biosynthesis protein FlhA OAN307:2.966..2.968 Mbp (2.133 kbp) score=10
OAN307_c29780 hypothetical protein OAN307:2.968..2.969 Mbp (1.323 kbp) score=10
OAN307_c29790 FliS-like flagellar synthesis protein OAN307:2.969..2.97 Mbp (420 bp) score=10
OAN307_c29800 hypothetical protein OAN307:2.97..2.97 Mbp (315 bp) score=10
OAN307_c29810 hypothetical protein OAN307:2.97..2.971 Mbp (489 bp) score=10
OAN307_c29850 hypothetical protein OAN307:2.973..2.974 Mbp (789 bp) score=10
OAN307_c29995 hypothetical protein OAN307:2.992..2.992 Mbp (621 bp) score=10
OAN307_c30000 hypothetical protein OAN307:2.993..2.993 Mbp (345 bp) score=10
OAN307_c30040 hypothetical protein OAN307:2.996..2.997 Mbp (123 bp) score=10
OAN307_c30080 hypothetical protein OAN307:3.001..3.002 Mbp (513 bp) score=10
OAN307_c30120 hypothetical protein OAN307:3.005..3.006 Mbp (345 bp) score=10
OAN307_c30130 hypothetical protein; transposase(fragment)-like OAN307:3.006..3.006 Mbp (330 bp) score=10
OAN307_c30140 hypothetical protein OAN307:3.007..3.008 Mbp (1.068 kbp) score=10
OAN307_c30180 hypothetical protein OAN307:3.01..3.011 Mbp (420 bp) score=10
OAN307_c30210 hypothetical protein OAN307:3.012..3.013 Mbp (195 bp) score=10
OAN307_c30230 hypothetical protein; transposase(fragment)-like OAN307:3.014..3.014 Mbp (282 bp) score=10
OAN307_c30250 putative pyridoxal phosphate biosynthetic protein; C-terminal fragment OAN307:3.015..3.015 Mbp (201 bp) score=10
OAN307_c30290 hypothetical protein OAN307:3.02..3.02 Mbp (633 bp) score=10
OAN307_c30320 hypothetical protein OAN307:3.023..3.023 Mbp (486 bp) score=10
OAN307_c30360 Hsp20-family heat shock protein associated with gas vesicle synthesis OAN307:3.027..3.028 Mbp (561 bp) score=10
OAN307_c30380 protein associated with gas vesicle synthesis OAN307:3.029..3.029 Mbp (255 bp) score=10
OAN307_c30460 hypothetical protein OAN307:3.033..3.033 Mbp (153 bp) score=10
OAN307_c30490 hypothetical protein OAN307:3.036..3.037 Mbp (555 bp) score=10
OAN307_c30580 hypothetical protein OAN307:3.045..3.045 Mbp (822 bp) score=10
OAN307_c30590 hypothetical protein OAN307:3.045..3.046 Mbp (330 bp) score=10
OAN307_c30600 hypothetical protein OAN307:3.046..3.046 Mbp (189 bp) score=10
OAN307_c30620 hypothetical protein OAN307:3.047..3.047 Mbp (249 bp) score=10
OAN307_c30630 hypothetical protein; integrase(fragment)-like OAN307:3.047..3.047 Mbp (420 bp) score=10
OAN307_c30680 hypothetical protein OAN307:3.051..3.052 Mbp (1.206 kbp) score=10
OAN307_c30690 hypothetical protein OAN307:3.053..3.053 Mbp (549 bp) score=10
OAN307_c30710 hypothetical protein DUF583 OAN307:3.055..3.055 Mbp (417 bp) score=10
OAN307_c30720 hypothetical protein OAN307:3.056..3.056 Mbp (195 bp) score=10
OAN307_c30750 hypothetical protein; integrase(fragment)-like OAN307:3.059..3.06 Mbp (642 bp) score=10
OAN307_c30810 hypothetical protein OAN307:3.065..3.065 Mbp (525 bp) score=10
OAN307_c30850 hypothetical protein OAN307:3.068..3.068 Mbp (690 bp) score=10
OAN307_c31060 hypothetical protein OAN307:3.086..3.087 Mbp (171 bp) score=10
OAN307_c31070 hypothetical protein OAN307:3.087..3.087 Mbp (603 bp) score=10
OAN307_c31330 hypothetical protein OAN307:3.112..3.113 Mbp (459 bp) score=10
OAN307_c31380 hypothetical protein OAN307:3.117..3.117 Mbp (192 bp) score=10
OAN307_c31390 hypothetical protein OAN307:3.117..3.117 Mbp (447 bp) score=10
OAN307_c31410 hypothetical protein OAN307:3.118..3.119 Mbp (597 bp) score=10
OAN307_c31420 hypothetical protein OAN307:3.119..3.12 Mbp (246 bp) score=10
OAN307_c31430 hypothetical protein OAN307:3.12..3.12 Mbp (267 bp) score=10
OAN307_c31450 hypothetical protein OAN307:3.122..3.122 Mbp (702 bp) score=10
OAN307_c31460 hypothetical protein OAN307:3.123..3.123 Mbp (228 bp) score=10
OAN307_c31470 hypothetical protein OAN307:3.123..3.123 Mbp (384 bp) score=10
OAN307_c31480 hypothetical protein OAN307:3.124..3.124 Mbp (171 bp) score=10
OAN307_c31510 hypothetical protein OAN307:3.127..3.128 Mbp (1.152 kbp) score=10
OAN307_c31530 hypothetical protein OAN307:3.129..3.129 Mbp (300 bp) score=10
OAN307_c31560 hypothetical protein OAN307:3.132..3.132 Mbp (462 bp) score=10
OAN307_c31610 hypothetical protein OAN307:3.137..3.137 Mbp (183 bp) score=10
OAN307_c31620 hypothetical protein OAN307:3.137..3.138 Mbp (624 bp) score=10
OAN307_c31630 hypothetical protein OAN307:3.138..3.138 Mbp (360 bp) score=10
OAN307_c31640 hypothetical protein OAN307:3.138..3.139 Mbp (645 bp) score=10
OAN307_c31660 hypothetical protein OAN307:3.14..3.141 Mbp (1.497 kbp) score=10
OAN307_c31670 hypothetical protein OAN307:3.141..3.142 Mbp (924 bp) score=10
OAN307_c31680 hypothetical protein OAN307:3.142..3.143 Mbp (186 bp) score=10
OAN307_c31700 hypothetical protein OAN307:3.143..3.143 Mbp (183 bp) score=10
OAN307_c31730 hypothetical protein OAN307:3.145..3.146 Mbp (474 bp) score=10
OAN307_c31740 hypothetical protein OAN307:3.146..3.147 Mbp (1.428 kbp) score=10
OAN307_c31750 hypothetical protein OAN307:3.147..3.147 Mbp (207 bp) score=10
OAN307_c31760 hypothetical protein; conserved, interrupted by frameshift OAN307:3.148..3.148 Mbp (377 bp) score=10
OAN307_c31780 hypothetical protein OAN307:3.148..3.148 Mbp (261 bp) score=10
OAN307_c31800 hypothetical protein OAN307:3.15..3.151 Mbp (195 bp) score=10
OAN307_c31810 hypothetical protein OAN307:3.151..3.151 Mbp (309 bp) score=10
OAN307_c31870 hypothetical protein OAN307:3.153..3.154 Mbp (585 bp) score=10
OAN307_c31880 hypothetical protein OAN307:3.154..3.154 Mbp (174 bp) score=10
OAN307_c31890 hypothetical protein OAN307:3.154..3.154 Mbp (192 bp) score=10
OAN307_c31900 hypothetical protein; integrase(fragment)-like OAN307:3.154..3.155 Mbp (375 bp) score=10
OAN307_c31920 hypothetical protein OAN307:3.156..3.156 Mbp (264 bp) score=10
OAN307_c31930 hypothetical protein; transposase(fragment)-like OAN307:3.156..3.156 Mbp (255 bp) score=10
OAN307_c32010 hypothetical protein OAN307:3.163..3.163 Mbp (273 bp) score=10
OAN307_c32030 hypothetical protein OAN307:3.165..3.165 Mbp (330 bp) score=10
OAN307_c32050 hypothetical protein OAN307:3.166..3.167 Mbp (714 bp) score=10
OAN307_c32060 hypothetical protein OAN307:3.167..3.168 Mbp (588 bp) score=10
OAN307_c32210 hypothetical protein OAN307:3.181..3.181 Mbp (336 bp) score=10
OAN307_c32230 hypothetical protein OAN307:3.185..3.185 Mbp (180 bp) score=10
OAN307_c32240 hypothetical protein OAN307:3.185..3.185 Mbp (168 bp) score=10
OAN307_c32250 hypothetical protein OAN307:3.185..3.186 Mbp (471 bp) score=10
OAN307_c32260 hypothetical protein OAN307:3.186..3.186 Mbp (426 bp) score=10
OAN307_c32280 hypothetical protein OAN307:3.188..3.189 Mbp (1.143 kbp) score=10
OAN307_c32350 hypothetical protein OAN307:3.199..3.199 Mbp (174 bp) score=10
OAN307_c32370 hypothetical protein OAN307:3.199..3.2 Mbp (345 bp) score=10
OAN307_c32380 hypothetical protein OAN307:3.2..3.2 Mbp (204 bp) score=10
OAN307_c32420 hypothetical protein OAN307:3.205..3.205 Mbp (534 bp) score=10
OAN307_c32440 hypothetical protein OAN307:3.207..3.208 Mbp (1.02 kbp) score=10
OAN307_c32450 hypothetical protein OAN307:3.208..3.209 Mbp (420 bp) score=10
OAN307_c32460 hypothetical protein OAN307:3.209..3.209 Mbp (198 bp) score=10
OAN307_c32470 hypothetical protein OAN307:3.209..3.21 Mbp (879 bp) score=10
OAN307_c32500 hypothetical protein OAN307:3.212..3.212 Mbp (366 bp) score=10
OAN307_c32510 aminoacyl-tRNA synthetase OAN307:3.212..3.213 Mbp (720 bp) score=10
OAN307_c32550 hypothetical protein OAN307:3.217..3.218 Mbp (441 bp) score=10
OAN307_c32610 hypothetical protein OAN307:3.223..3.224 Mbp (726 bp) score=10
OAN307_c32620 hypothetical protein OAN307:3.224..3.225 Mbp (786 bp) score=10
OAN307_c32640 hypothetical protein OAN307:3.226..3.226 Mbp (354 bp) score=10
OAN307_c32680 hypothetical protein OAN307:3.229..3.229 Mbp (354 bp) score=10
OAN307_c32730 hypothetical protein OAN307:3.233..3.234 Mbp (753 bp) score=10
OAN307_c32750 hypothetical protein OAN307:3.235..3.235 Mbp (204 bp) score=10
OAN307_c32830 hypothetical protein OAN307:3.242..3.243 Mbp (1.548 kbp) score=10
OAN307_c32840 hypothetical protein UPF717 OAN307:3.243..3.244 Mbp (582 bp) score=10
OAN307_c32850 hypothetical protein OAN307:3.244..3.244 Mbp (375 bp) score=10
OAN307_c32880 hypothetical protein; interupted by frameshift OAN307:3.247..3.247 Mbp (452 bp) score=10
OAN307_c32900 hypothetical protein OAN307:3.247..3.248 Mbp (396 bp) score=10
OAN307_c32920 hypothetical protein OAN307:3.249..3.251 Mbp (1.674 kbp) score=10
OAN307_c32930 hypothetical protein OAN307:3.251..3.252 Mbp (1.005 kbp) score=10
OAN307_c32940 hypothetical protein OAN307:3.252..3.252 Mbp (522 bp) score=10
OAN307_c32950 hypothetical protein OAN307:3.252..3.253 Mbp (432 bp) score=10
OAN307_c32970 hypothetical protein OAN307:3.254..3.254 Mbp (660 bp) score=10
OAN307_c33010 hypothetical protein OAN307:3.259..3.259 Mbp (213 bp) score=10
OAN307_c33020 hypothetical protein OAN307:3.259..3.259 Mbp (243 bp) score=10
OAN307_c33050 hypothetical protein OAN307:3.262..3.263 Mbp (489 bp) score=10
OAN307_c33060 hypothetical protein DUF1289 OAN307:3.263..3.263 Mbp (261 bp) score=10
OAN307_c33070 hypothetical protein OAN307:3.263..3.264 Mbp (747 bp) score=10
OAN307_c33080 hypothetical protein OAN307:3.264..3.264 Mbp (819 bp) score=10
OAN307_c33110 hypothetical protein OAN307:3.267..3.267 Mbp (297 bp) score=10
OAN307_c33120 hypothetical protein OAN307:3.267..3.268 Mbp (168 bp) score=10
OAN307_c33130 hypothetical protein OAN307:3.268..3.268 Mbp (270 bp) score=10
OAN307_c33170 hypothetical protein OAN307:3.271..3.271 Mbp (246 bp) score=10
OAN307_c33190 hypothetical protein OAN307:3.275..3.275 Mbp (456 bp) score=10
OAN307_c33220 hypothetical protein DUF59 OAN307:3.278..3.278 Mbp (363 bp) score=10
OAN307_c33230 hypothetical protein OAN307:3.279..3.279 Mbp (606 bp) score=10
OAN307_c33240 hypothetical protein OAN307:3.279..3.28 Mbp (720 bp) score=10
OAN307_c33250 hypothetical protein OAN307:3.28..3.28 Mbp (360 bp) score=10
OAN307_c33260 hypothetical protein OAN307:3.28..3.281 Mbp (252 bp) score=10
OAN307_c33270 hypothetical protein OAN307:3.281..3.281 Mbp (588 bp) score=10
OAN307_c33360 hypothetical protein OAN307:3.291..3.292 Mbp (798 bp) score=10
OAN307_c33380 hypothetical protein OAN307:3.293..3.294 Mbp (603 bp) score=10
OAN307_c33400 hypothetical protein OAN307:3.296..3.296 Mbp (180 bp) score=10
OAN307_c33410 hypothetical protein OAN307:3.296..3.296 Mbp (246 bp) score=10
OAN307_c33430 hypothetical protein OAN307:3.297..3.299 Mbp (1.332 kbp) score=10
OAN307_c33470 hypothetical protein OAN307:3.303..3.304 Mbp (590 bp) score=10
OAN307_c33530 hypothetical protein DUF1476 OAN307:3.309..3.309 Mbp (315 bp) score=10
OAN307_c33540 hypothetical membrane protein DUF2156; interrupted by pointmutation OAN307:3.309..3.311 Mbp (1.929 kbp) score=10
OAN307_c33590 hypothetical protein OAN307:3.314..3.314 Mbp (639 bp) score=10
OAN307_c33610 hypothetical protein; transposase(fragment)-like OAN307:3.315..3.316 Mbp (624 bp) score=10
OAN307_c33630 hypothetical protein OAN307:3.317..3.317 Mbp (486 bp) score=10
OAN307_c33670 hypothetical protein OAN307:3.32..3.321 Mbp (318 bp) score=10
OAN307_c33680 hypothetical protein OAN307:3.321..3.321 Mbp (360 bp) score=10
OAN307_c33690 hypothetical protein DUF2333 OAN307:3.321..3.322 Mbp (1.083 kbp) score=10
OAN307_c33700 hypothetical protein OAN307:3.323..3.325 Mbp (2.226 kbp) score=10
OAN307_c33710 hypothetical protein OAN307:3.325..3.325 Mbp (198 bp) score=10
OAN307_c33720 hypothetical protein OAN307:3.326..3.327 Mbp (1.425 kbp) score=10
OAN307_c33740 hypothetical protein OAN307:3.328..3.329 Mbp (789 bp) score=10
OAN307_c33750 hypothetical protein OAN307:3.329..3.329 Mbp (153 bp) score=10
OAN307_c33760 hypothetical protein OAN307:3.329..3.33 Mbp (120 bp) score=10
OAN307_c33800 hypothetical protein OAN307:3.331..3.332 Mbp (900 bp) score=10
OAN307_c33890 hypothetical protein; transposase(fragment)-like OAN307:3.34..3.34 Mbp (285 bp) score=10
OAN307_c33900 hypothetical protein; transposase(fragment)-like OAN307:3.34..3.341 Mbp (699 bp) score=10
OAN307_c33920 hypothetical protein OAN307:3.342..3.342 Mbp (246 bp) score=10
OAN307_c33960 hypothetical protein OAN307:3.345..3.346 Mbp (1.2 kbp) score=10
OAN307_c34050 hypothetical protein; transposase(fragment)-like OAN307:3.357..3.358 Mbp (749 bp) score=10
OAN307_c34060 hypothetical protein; transposase(fragment)-like OAN307:3.358..3.359 Mbp (567 bp) score=10
OAN307_c34070 hypothetical protein; integrase(fragment)-like OAN307:3.359..3.36 Mbp (1.059 kbp) score=10
OAN307_c34090 hypothetical protein OAN307:3.362..3.362 Mbp (159 bp) score=10
OAN307_c34100 hypothetical protein OAN307:3.362..3.362 Mbp (387 bp) score=10
OAN307_c34160 hypothetical protein OAN307:3.366..3.366 Mbp (219 bp) score=10
OAN307_c34170 hypothetical protein OAN307:3.366..3.366 Mbp (180 bp) score=10
OAN307_c34180 hypothetical protein OAN307:3.366..3.367 Mbp (165 bp) score=10
OAN307_c34200 hypothetical protein OAN307:3.368..3.368 Mbp (219 bp) score=10
metG methionyl-tRNA synthetase MetG OAN307:3.369..3.371 Mbp (1.713 kbp) score=10
OAN307_c34230 hypothetical protein OAN307:3.372..3.372 Mbp (516 bp) score=10
OAN307_c34260 hypothetical protein OAN307:3.374..3.374 Mbp (249 bp) score=10
OAN307_c34270 hypothetical protein; transposase(fragment)-like OAN307:3.374..3.375 Mbp (216 bp) score=10
OAN307_c34280 hypothetical protein OAN307:3.375..3.375 Mbp (432 bp) score=10
OAN307_c34320 hypothetical protein OAN307:3.379..3.379 Mbp (537 bp) score=10
OAN307_c34380 hypothetical protein OAN307:3.385..3.385 Mbp (384 bp) score=10
OAN307_c34430 hypothetical protein/IS110-family transposase-fusion protein OAN307:3.39..3.392 Mbp (1.242 kbp) score=10
OAN307_c34440 hypothetical protein; transposase(fragment)-like OAN307:3.392..3.392 Mbp (454 bp) score=10
OAN307_c34450 hypothetical protein; transposase(fragment)-like OAN307:3.393..3.393 Mbp (168 bp) score=10
OAN307_c34490 hypothetical protein OAN307:3.395..3.395 Mbp (249 bp) score=10
OAN307_c34500 hypothetical protein; transposase(fragment)-like OAN307:3.396..3.396 Mbp (360 bp) score=10
OAN307_c34510 hypothetical protein DUF2235 OAN307:3.396..3.397 Mbp (1.065 kbp) score=10
valS valyl-tRNA synthetase ValS OAN307:3.4..3.403 Mbp (3.165 kbp) score=10
OAN307_c34590 hypothetical protein OAN307:3.41..3.411 Mbp (333 bp) score=10
OAN307_c34600 hypothetical protein OAN307:3.411..3.411 Mbp (141 bp) score=10
OAN307_c34610 hypothetical protein OAN307:3.411..3.411 Mbp (207 bp) score=10
OAN307_c34630 hypothetical protein OAN307:3.413..3.414 Mbp (1.146 kbp) score=10
OAN307_c34670 hypothetical protein OAN307:3.416..3.417 Mbp (513 bp) score=10
OAN307_c34690 hypothetical protein OAN307:3.417..3.418 Mbp (477 bp) score=10
OAN307_c34700 hypothetical protein OAN307:3.419..3.419 Mbp (294 bp) score=10
OAN307_c34720 hypothetical protein OAN307:3.42..3.42 Mbp (195 bp) score=10
OAN307_c34730 hypothetical protein OAN307:3.421..3.421 Mbp (624 bp) score=10
OAN307_c34770 hypothetical protein OAN307:3.424..3.424 Mbp (210 bp) score=10
OAN307_c34830 hypothetical protein OAN307:3.427..3.427 Mbp (180 bp) score=10
OAN307_c34840 hypothetical protein OAN307:3.427..3.427 Mbp (198 bp) score=10
OAN307_c34860 hypothetical protein OAN307:3.429..3.43 Mbp (288 bp) score=10
OAN307_c34870 hypothetical protein OAN307:3.43..3.43 Mbp (699 bp) score=10
OAN307_c35050 hypothetical protein OAN307:3.452..3.453 Mbp (519 bp) score=10
OAN307_c35060 hypothetical protein OAN307:3.453..3.453 Mbp (408 bp) score=10
OAN307_c35070 hypothetical protein OAN307:3.454..3.455 Mbp (1.152 kbp) score=10
OAN307_c35080 hypothetical protein OAN307:3.455..3.456 Mbp (276 bp) score=10
OAN307_c35090 hypothetical protein OAN307:3.456..3.456 Mbp (270 bp) score=10
OAN307_c35110 hypothetical protein DUF1486 OAN307:3.459..3.46 Mbp (978 bp) score=10
OAN307_c35120 hypothetical protein OAN307:3.46..3.46 Mbp (711 bp) score=10
OAN307_c35130 hypothetical protein OAN307:3.461..3.462 Mbp (987 bp) score=10
OAN307_c35190 hypothetical protein OAN307:3.468..3.469 Mbp (1.029 kbp) score=10
OAN307_c35230 hypothetical protein OAN307:3.472..3.473 Mbp (1.017 kbp) score=10
OAN307_c35240 hypothetical protein OAN307:3.473..3.474 Mbp (1.125 kbp) score=10
OAN307_c35260 hypothetical protein OAN307:3.475..3.475 Mbp (396 bp) score=10
OAN307_c35280 hypothetical protein OAN307:3.476..3.477 Mbp (822 bp) score=10
OAN307_c35320 hypothetical protein OAN307:3.48..3.48 Mbp (807 bp) score=10
OAN307_c35330 hypothetical protein OAN307:3.48..3.481 Mbp (186 bp) score=10
OAN307_c35340 hypothetical protein OAN307:3.481..3.481 Mbp (408 bp) score=10
OAN307_c35350 hypothetical protein OAN307:3.481..3.482 Mbp (744 bp) score=10
OAN307_c35360 hypothetical protein OAN307:3.482..3.483 Mbp (201 bp) score=10
OAN307_c35400 hypothetical protein OAN307:3.487..3.487 Mbp (201 bp) score=10
OAN307_c35420 hypothetical protein OAN307:3.49..3.491 Mbp (1.068 kbp) score=10
OAN307_c35440 hypothetical protein OAN307:3.493..3.493 Mbp (513 bp) score=10
OAN307_c35450 hypothetical protein; integrase(fragment)-like OAN307:3.493..3.494 Mbp (264 bp) score=10
OAN307_c35460 hypothetical protein OAN307:3.494..3.494 Mbp (381 bp) score=10
OAN307_c35490 hypothetical protein OAN307:3.497..3.497 Mbp (405 bp) score=10
OAN307_c35510 hypothetical protein OAN307:3.498..3.501 Mbp (3.543 kbp) score=10
OAN307_c35520 hypothetical protein OAN307:3.502..3.504 Mbp (2.112 kbp) score=10
OAN307_c35530 hypothetical protein OAN307:3.504..3.504 Mbp (264 bp) score=10
OAN307_c35550 hypothetical protein OAN307:3.505..3.506 Mbp (918 bp) score=10
OAN307_c35580 hypothetical protein OAN307:3.508..3.509 Mbp (1.155 kbp) score=10
OAN307_c35620 hypothetical protein OAN307:3.512..3.512 Mbp (330 bp) score=10
OAN307_c35630 hypothetical protein OAN307:3.512..3.512 Mbp (288 bp) score=10
OAN307_c35640 hypothetical protein DUF1498 OAN307:3.512..3.513 Mbp (684 bp) score=10
OAN307_c35700 hypothetical protein OAN307:3.518..3.518 Mbp (618 bp) score=10
OAN307_c35710 hypothetical protein OAN307:3.518..3.519 Mbp (465 bp) score=10
OAN307_c35740 hypothetical protein OAN307:3.521..3.521 Mbp (528 bp) score=10
OAN307_c35750 hypothetical protein OAN307:3.521..3.522 Mbp (525 bp) score=10
OAN307_c35760 hypothetical protein OAN307:3.522..3.523 Mbp (816 bp) score=10
OAN307_c35770 hypothetical protein OAN307:3.523..3.523 Mbp (279 bp) score=10
OAN307_c35810 hypothetical protein OAN307:3.526..3.527 Mbp (654 bp) score=10
OAN307_c35820 hypothetical protein OAN307:3.527..3.527 Mbp (213 bp) score=10
OAN307_c35830 hypothetical protein OAN307:3.527..3.528 Mbp (441 bp) score=10
OAN307_c35840 hypothetical protein OAN307:3.528..3.529 Mbp (1.167 kbp) score=10
OAN307_c35860 hypothetical protein OAN307:3.531..3.531 Mbp (540 bp) score=10
alaS alanyl-tRNA synthetase AlaS OAN307:3.534..3.536 Mbp (2.655 kbp) score=10
OAN307_c35910 hypothetical protein OAN307:3.538..3.538 Mbp (597 bp) score=10
cls cardiolipin synthetase Cls OAN307:3.54..3.541 Mbp (1.449 kbp) score=10
OAN307_c35940 hypothetical protein OAN307:3.541..3.542 Mbp (699 bp) score=10
OAN307_c35980 hypothetical protein OAN307:3.544..3.544 Mbp (273 bp) score=10
OAN307_c35990 hypothetical protein OAN307:3.544..3.544 Mbp (183 bp) score=10
OAN307_c36020 hypothetical protein; transposase(fragment)-like OAN307:3.546..3.546 Mbp (180 bp) score=10
OAN307_c36100 hypothetical protein OAN307:3.554..3.555 Mbp (567 bp) score=10
OAN307_c36200 hypothetical protein OAN307:3.568..3.568 Mbp (672 bp) score=10
OAN307_c36220 hypothetical protein OAN307:3.57..3.57 Mbp (300 bp) score=10
OAN307_c36250 hypothetical protein DUF2309 OAN307:3.573..3.575 Mbp (2.331 kbp) score=10
OAN307_c36300 hypothetical protein OAN307:3.582..3.584 Mbp (2.442 kbp) score=10
OAN307_c36330 hypothetical protein OAN307:3.587..3.588 Mbp (255 bp) score=10
OAN307_c36440 hypothetical protein OAN307:3.6..3.6 Mbp (246 bp) score=10
OAN307_c36450 hypothetical protein; transposase(N-terminal fragment)-like OAN307:3.601..3.601 Mbp (418 bp) score=10
OAN307_c36500 hypothetical protein OAN307:3.603..3.604 Mbp (381 bp) score=10
OAN307_c36510 hypothetical protein OAN307:3.604..3.604 Mbp (276 bp) score=10
OAN307_c36530 hypothetical protein OAN307:3.605..3.605 Mbp (339 bp) score=10
OAN307_c36550 hypothetical protein OAN307:3.606..3.607 Mbp (207 bp) score=10
OAN307_c36630 hypothetical protein OAN307:3.61..3.61 Mbp (375 bp) score=10
OAN307_c36650 putative autoinducer synthesis protein OAN307:3.612..3.612 Mbp (690 bp) score=10
OAN307_c36670 hypothetical protein OAN307:3.614..3.614 Mbp (219 bp) score=10
OAN307_c36680 hypothetical protein OAN307:3.615..3.615 Mbp (312 bp) score=10
OAN307_c36690 hypothetical protein OAN307:3.615..3.616 Mbp (261 bp) score=10
OAN307_c36730 hypothetical protein OAN307:3.617..3.618 Mbp (1.041 kbp) score=10
OAN307_c36740 hypothetical protein OAN307:3.619..3.619 Mbp (282 bp) score=10
OAN307_c36770 hypothetical protein OAN307:3.621..3.621 Mbp (657 bp) score=10
OAN307_c36780 hypothetical protein DUF1992 OAN307:3.621..3.622 Mbp (450 bp) score=10
OAN307_c36790 hypothetical protein OAN307:3.622..3.624 Mbp (1.425 kbp) score=10
OAN307_c36810 hypothetical protein DUF952 OAN307:3.626..3.627 Mbp (378 bp) score=10
OAN307_c36900 hypothetical protein OAN307:3.633..3.634 Mbp (213 bp) score=10
OAN307_c36940 hypothetical protein OAN307:3.638..3.639 Mbp (654 bp) score=10
OAN307_c36950 hypothetical protein OAN307:3.639..3.639 Mbp (432 bp) score=10
OAN307_c36960 hypothetical protein OAN307:3.64..3.64 Mbp (654 bp) score=10
OAN307_c37010 hypothetical protein OAN307:3.645..3.646 Mbp (1.017 kbp) score=10
OAN307_c37080 hypothetical protein OAN307:3.653..3.654 Mbp (1.135 kbp) score=10
OAN307_c37110 hypothetical protein OAN307:3.659..3.66 Mbp (780 bp) score=10
OAN307_c37140 hypothetical protein OAN307:3.662..3.663 Mbp (408 bp) score=10
OAN307_c37160 hypothetical protein OAN307:3.664..3.664 Mbp (183 bp) score=10
OAN307_c37170 hypothetical protein OAN307:3.664..3.665 Mbp (759 bp) score=10
OAN307_c37190 hypothetical protein OAN307:3.667..3.668 Mbp (1.242 kbp) score=10
OAN307_c37200 hypothetical protein OAN307:3.669..3.669 Mbp (336 bp) score=10
OAN307_c37210 hypothetical protein DUF461 OAN307:3.669..3.67 Mbp (666 bp) score=10
OAN307_c37260 hypothetical protein OAN307:3.676..3.676 Mbp (759 bp) score=10
OAN307_c37330 hypothetical protein OAN307:3.682..3.683 Mbp (528 bp) score=10
OAN307_c37340 hypothetical protein OAN307:3.683..3.683 Mbp (516 bp) score=10
OAN307_c37360 hypothetical protein OAN307:3.684..3.684 Mbp (369 bp) score=10
OAN307_c37370 hypothetical protein OAN307:3.685..3.685 Mbp (135 bp) score=10
OAN307_c37380 hypothetical protein; transposase(fragment)-like OAN307:3.685..3.685 Mbp (213 bp) score=10
OAN307_c37390 hypothetical protein OAN307:3.685..3.685 Mbp (297 bp) score=10
OAN307_c37410 hypothetical protein; transposase(fragment)-like OAN307:3.687..3.688 Mbp (898 bp) score=10
OAN307_c37430 hypothetical protein OAN307:3.688..3.688 Mbp (297 bp) score=10
OAN307_c37440 hypothetical protein; transposase(fragment)-like OAN307:3.688..3.689 Mbp (432 bp) score=10
OAN307_c37460 hypothetical protein OAN307:3.69..3.691 Mbp (888 bp) score=10
OAN307_c37470 hypothetical protein OAN307:3.691..3.691 Mbp (345 bp) score=10
OAN307_c37500 hypothetical protein OAN307:3.692..3.693 Mbp (216 bp) score=10
OAN307_c37510 hypothetical protein OAN307:3.692..3.693 Mbp (318 bp) score=10
OAN307_c37520 hypothetical protein OAN307:3.693..3.693 Mbp (180 bp) score=10
OAN307_c37600 hypothetical protein OAN307:3.699..3.699 Mbp (216 bp) score=10
OAN307_c37650 hypothetical protein OAN307:3.702..3.702 Mbp (354 bp) score=10
OAN307_c37680 hypothetical protein OAN307:3.706..3.707 Mbp (504 bp) score=10
OAN307_c37690 hypothetical protein OAN307:3.706..3.707 Mbp (297 bp) score=10
OAN307_c37760 hypothetical protein OAN307:3.71..3.712 Mbp (1.155 kbp) score=10
OAN307_c37780 hypothetical protein OAN307:3.714..3.715 Mbp (432 bp) score=10
hisS histidyl-tRNA synthetase HisS OAN307:3.717..3.718 Mbp (1.572 kbp) score=10
OAN307_c37830 hypothetical protein OAN307:3.719..3.72 Mbp (864 bp) score=10
OAN307_c37910 hypothetical protein OAN307:3.731..3.732 Mbp (321 bp) score=10
OAN307_c37940 hypothetical protein OAN307:3.734..3.734 Mbp (309 bp) score=10
OAN307_c37960 hypothetical protein; C-terminal fragment OAN307:3.736..3.737 Mbp (489 bp) score=10
OAN307_c38000 hypothetical protein; transposase(fragment)-like OAN307:3.738..3.739 Mbp (1.057 kbp) score=10
OAN307_c38040 hypothetical protein; transposase(fragment)-like OAN307:3.741..3.742 Mbp (943 bp) score=10
OAN307_c38050 hypothetical protein OAN307:3.742..3.742 Mbp (402 bp) score=10
OAN307_c38070 hypothetical protein OAN307:3.744..3.744 Mbp (252 bp) score=10
OAN307_c38090 hypothetical protein OAN307:3.745..3.746 Mbp (1.209 kbp) score=10
OAN307_c38110 hypothetical protein OAN307:3.747..3.748 Mbp (279 bp) score=10
OAN307_c38120 hypothetical protein OAN307:3.748..3.748 Mbp (198 bp) score=10
OAN307_c38160 hypothetical protein; transposase(fragment)-like OAN307:3.751..3.752 Mbp (354 bp) score=10
OAN307_c38230 putative lipid A biosynthesis lauroyl acyltransferase OAN307:3.759..3.76 Mbp (906 bp) score=10
OAN307_c38370 hypothetical protein OAN307:3.776..3.776 Mbp (462 bp) score=10
OAN307_c38380 hypothetical protein DUF1178 OAN307:3.776..3.777 Mbp (459 bp) score=10
OAN307_c38400 hypothetical protein OAN307:3.777..3.778 Mbp (654 bp) score=10
OAN307_c38430 hypothetical protein OAN307:3.781..3.781 Mbp (666 bp) score=10
OAN307_c38450 hypothetical protein OAN307:3.782..3.783 Mbp (810 bp) score=10
OAN307_c38530 hypothetical protein OAN307:3.791..3.792 Mbp (666 bp) score=10
OAN307_c38560 hypothetical protein OAN307:3.794..3.794 Mbp (270 bp) score=10
OAN307_c38640 hypothetical protein OAN307:3.804..3.805 Mbp (1.02 kbp) score=10
OAN307_c38690 hypothetical protein OAN307:3.81..3.81 Mbp (186 bp) score=10
OAN307_c38700 hypothetical protein OAN307:3.81..3.81 Mbp (507 bp) score=10
OAN307_c38710 hypothetical protein OAN307:3.81..3.811 Mbp (408 bp) score=10
OAN307_c38720 hypothetical protein OAN307:3.811..3.811 Mbp (429 bp) score=10
OAN307_c38730 hypothetical protein OAN307:3.811..3.812 Mbp (453 bp) score=10
OAN307_c38780 hypothetical protein; transposase(fragment)-like OAN307:3.818..3.818 Mbp (504 bp) score=10
OAN307_c38790 hypothetical protein; transposase(fragment)-like OAN307:3.818..3.819 Mbp (420 bp) score=10
OAN307_c38800 hypothetical protein OAN307:3.819..3.82 Mbp (300 bp) score=10
OAN307_c38810 hypothetical protein; integrase(fragment)-like OAN307:3.82..3.821 Mbp (348 bp) score=10
moeB molybdopterin biosynthesis protein MoeB OAN307:3.827..3.829 Mbp (1.044 kbp) score=10
cobP bifunctional adenosylcobalamin biosynthesis protein CobP OAN307:3.831..3.832 Mbp (534 bp) score=10
OAN307_c39010 hypothetical protein OAN307:3.838..3.839 Mbp (1.212 kbp) score=10
OAN307_c39030 hypothetical protein; transposase(fragment)-like OAN307:3.842..3.842 Mbp (300 bp) score=10
OAN307_c39170 hypothetical protein OAN307:3.859..3.861 Mbp (2.061 kbp) score=10
OAN307_c39180 hypothetical protein OAN307:3.861..3.861 Mbp (102 bp) score=10
OAN307_c39190 hypothetical protein OAN307:3.862..3.862 Mbp (405 bp) score=10
OAN307_c39200 hypothetical protein OAN307:3.862..3.863 Mbp (180 bp) score=10
OAN307_c39210 hypothetical protein; integrase(fragment)-like OAN307:3.863..3.863 Mbp (801 bp) score=10
OAN307_c39220 hypothetical protein; integrase(fragment)-like OAN307:3.863..3.864 Mbp (396 bp) score=10
OAN307_c39230 hypothetical protein OAN307:3.864..3.865 Mbp (507 bp) score=10
OAN307_c39240 hypothetical protein OAN307:3.865..3.865 Mbp (543 bp) score=10
OAN307_c39250 hypothetical protein OAN307:3.865..3.865 Mbp (303 bp) score=10
OAN307_c39260 hypothetical protein OAN307:3.866..3.866 Mbp (267 bp) score=10
OAN307_c39270 hypothetical protein OAN307:3.866..3.866 Mbp (174 bp) score=10
OAN307_c39280 hypothetical protein OAN307:3.866..3.866 Mbp (225 bp) score=10
OAN307_c39290 hypothetical protein OAN307:3.866..3.867 Mbp (429 bp) score=10
OAN307_c39300 hypothetical protein OAN307:3.867..3.867 Mbp (315 bp) score=10
OAN307_c39310 hypothetical protein OAN307:3.867..3.867 Mbp (261 bp) score=10
OAN307_c39320 hypothetical protein OAN307:3.867..3.868 Mbp (180 bp) score=10
OAN307_c39340 hypothetical protein OAN307:3.868..3.868 Mbp (171 bp) score=10
OAN307_c39350 hypothetical protein OAN307:3.868..3.869 Mbp (852 bp) score=10
OAN307_c39360 hypothetical protein OAN307:3.869..3.87 Mbp (681 bp) score=10
OAN307_c39410 hypothetical protein; containing EAL-domain, interrupted by frameshift OAN307:3.874..3.875 Mbp (962 bp) score=10
OAN307_c39430 hypothetical protein OAN307:3.876..3.877 Mbp (807 bp) score=10
OAN307_c39450 hypothetical protein OAN307:3.878..3.879 Mbp (375 bp) score=10
OAN307_c39460 hypothetical protein OAN307:3.879..3.88 Mbp (999 bp) score=10
OAN307_c39490 hypothetical protein OAN307:3.882..3.882 Mbp (351 bp) score=10
OAN307_c39550 hypothetical protein OAN307:3.888..3.889 Mbp (552 bp) score=10
OAN307_c39560 hypothetical protein OAN307:3.889..3.89 Mbp (648 bp) score=10
OAN307_c39590 hypothetical protein OAN307:3.891..3.891 Mbp (384 bp) score=10
metK S-adenosylmethionine synthetase MetK OAN307:3.894..3.895 Mbp (1.182 kbp) score=10
OAN307_c39670 hypothetical protein OAN307:3.899..3.899 Mbp (309 bp) score=10
OAN307_c39680 hypothetical protein OAN307:3.899..3.9 Mbp (636 bp) score=10
OAN307_c39700 hypothetical protein OAN307:3.901..3.902 Mbp (867 bp) score=10
OAN307_c39710 hypothetical protein OAN307:3.902..3.903 Mbp (483 bp) score=10
OAN307_c39740 hypothetical protein OAN307:3.904..3.905 Mbp (705 bp) score=10
OAN307_c39790 hypothetical protein OAN307:3.909..3.909 Mbp (408 bp) score=10
OAN307_c39830 hypothetical protein OAN307:3.912..3.913 Mbp (1.242 kbp) score=10
OAN307_c39910 hypothetical protein OAN307:3.92..3.921 Mbp (909 bp) score=10
OAN307_c39920 hypothetical protein OAN307:3.921..3.923 Mbp (1.26 kbp) score=10
OAN307_c39940 hypothetical protein OAN307:3.924..3.924 Mbp (249 bp) score=10
OAN307_c39950 hypothetical protein OAN307:3.924..3.925 Mbp (540 bp) score=10
OAN307_c39960 hypothetical protein; transposase(fragment)-like OAN307:3.925..3.925 Mbp (189 bp) score=10
OAN307_c39970 hypothetical protein OAN307:3.925..3.925 Mbp (168 bp) score=10
OAN307_c39980 hypothetical protein; transposase(fragment)-like OAN307:3.925..3.925 Mbp (303 bp) score=10
OAN307_c39990 hypothetical protein OAN307:3.925..3.926 Mbp (321 bp) score=10
OAN307_c40000 hypothetical protein OAN307:3.926..3.926 Mbp (195 bp) score=10
OAN307_c40020 hypothetical protein; interrupted by pointmutation OAN307:3.928..3.929 Mbp (1.767 kbp) score=10
OAN307_c40040 hypothetical protein OAN307:3.93..3.93 Mbp (591 bp) score=10
OAN307_c40050 hypothetical protein OAN307:3.93..3.931 Mbp (423 bp) score=10
OAN307_c40060 hypothetical protein OAN307:3.931..3.931 Mbp (363 bp) score=10
OAN307_c40070 hypothetical protein OAN307:3.931..3.932 Mbp (594 bp) score=10
OAN307_c40130 hypothetical protein OAN307:3.935..3.935 Mbp (624 bp) score=10
OAN307_c40140 hypothetical protein OAN307:3.936..3.937 Mbp (159 bp) score=10
OAN307_c40200 hypothetical protein OAN307:3.94..3.94 Mbp (399 bp) score=10
OAN307_c40220 hypothetical protein OAN307:3.941..3.941 Mbp (213 bp) score=10
OAN307_c40240 hypothetical protein OAN307:3.944..3.945 Mbp (453 bp) score=10
OAN307_c40250 hypothetical protein OAN307:3.945..3.945 Mbp (342 bp) score=10
OAN307_c40270 hypothetical protein OAN307:3.946..3.948 Mbp (2.286 kbp) score=10
OAN307_c40280 hypothetical protein OAN307:3.948..3.949 Mbp (402 bp) score=10
lysS lysyl-tRNA synthetase LysS OAN307:3.949..3.95 Mbp (1.65 kbp) score=10
OAN307_c40300 hypothetical protein OAN307:3.951..3.951 Mbp (420 bp) score=10
OAN307_c40350 hypothetical protein OAN307:3.957..3.957 Mbp (264 bp) score=10
OAN307_c40360 hypothetical protein; transposase(fragment)-like OAN307:3.957..3.958 Mbp (279 bp) score=10
OAN307_c40370 hypothetical protein; transposase(fragment)-like OAN307:3.958..3.958 Mbp (495 bp) score=10
OAN307_c40400 hypothetical protein OAN307:3.96..3.96 Mbp (297 bp) score=10
OAN307_c40410 hypothetical protein OAN307:3.96..3.961 Mbp (525 bp) score=10
OAN307_c40430 hypothetical protein OAN307:3.962..3.962 Mbp (312 bp) score=10
OAN307_c40440 hypothetical protein OAN307:3.962..3.962 Mbp (567 bp) score=10
gltX1 glutamyl-tRNA synthetase OAN307:3.968..3.969 Mbp (1.323 kbp) score=10
OAN307_c40490 hypothetical protein OAN307:3.969..3.969 Mbp (189 bp) score=10
OAN307_c40510 hypothetical protein OAN307:3.971..3.971 Mbp (270 bp) score=10
OAN307_c40520 hypothetical protein OAN307:3.971..3.971 Mbp (360 bp) score=10
OAN307_c40590 hypothetical protein OAN307:3.975..3.976 Mbp (861 bp) score=10
OAN307_c40660 hypothetical protein OAN307:3.981..3.982 Mbp (1.191 kbp) score=10
OAN307_c40680 hypothetical protein OAN307:3.985..3.985 Mbp (186 bp) score=10
OAN307_c40700 hypothetical protein; transposase(fragment)-like OAN307:3.986..3.986 Mbp (213 bp) score=10
OAN307_c40710 hypothetical protein OAN307:3.986..3.987 Mbp (510 bp) score=10
OAN307_c40730 hypothetical protein OAN307:3.987..3.988 Mbp (1.065 kbp) score=10
OAN307_c40760 hypothetical protein OAN307:3.99..3.991 Mbp (258 bp) score=10
OAN307_c40770 hypothetical protein; transposase(fragment)-like OAN307:3.991..3.991 Mbp (372 bp) score=10
OAN307_c40845 hypothetical protein OAN307:3.998..3.998 Mbp (4 bp) score=10
OAN307_c40850 hypothetical protein OAN307:4..4 Mbp (255 bp) score=10
OAN307_c40910 hypothetical protein OAN307:4.008..4.008 Mbp (192 bp) score=10
OAN307_c40970 hypothetical protein OAN307:4.013..4.014 Mbp (198 bp) score=10
OAN307_c41010 hypothetical protein OAN307:4.017..4.018 Mbp (222 bp) score=10
OAN307_c41020 hypothetical protein OAN307:4.017..4.018 Mbp (156 bp) score=10
OAN307_c41030 hypothetical protein; transposase(fragment)-like OAN307:4.018..4.018 Mbp (207 bp) score=10
OAN307_c41040 hypothetical protein OAN307:4.018..4.018 Mbp (261 bp) score=10
OAN307_c41050 hypothetical protein; transposase(fragment)-like OAN307:4.019..4.019 Mbp (372 bp) score=10
OAN307_c41100 hypothetical protein; transposase(fragment)-like OAN307:4.022..4.023 Mbp (213 bp) score=10
OAN307_c41110 hypothetical protein OAN307:4.024..4.024 Mbp (342 bp) score=10
trpS tryptophanyl-tRNA synthetase TrpS OAN307:4.028..4.029 Mbp (1.02 kbp) score=10
OAN307_c41160 hypothetical protein OAN307:4.029..4.03 Mbp (843 bp) score=10
OAN307_c41180 hypothetical protein OAN307:4.03..4.031 Mbp (201 bp) score=10
OAN307_c41210 hypothetical protein OAN307:4.032..4.032 Mbp (426 bp) score=10
OAN307_c41230 hypothetical protein OAN307:4.034..4.034 Mbp (351 bp) score=10
OAN307_c41280 hypothetical protein DUF1925 OAN307:4.039..4.039 Mbp (918 bp) score=10
OAN307_c41340 hypothetical protein OAN307:4.044..4.044 Mbp (210 bp) score=10
OAN307_c41360 hypothetical protein OAN307:4.046..4.046 Mbp (360 bp) score=10
OAN307_c41370 hypothetical protein OAN307:4.046..4.048 Mbp (1.395 kbp) score=10
OAN307_c41400 hypothetical protein OAN307:4.05..4.051 Mbp (378 bp) score=10
OAN307_c41420 hypothetical protein DUF1989 OAN307:4.052..4.053 Mbp (843 bp) score=10
OAN307_c41440 hypothetical protein OAN307:4.054..4.054 Mbp (282 bp) score=10
OAN307_c41480 hypothetical protein OAN307:4.057..4.058 Mbp (258 bp) score=10
OAN307_c41500 hypothetical protein OAN307:4.059..4.059 Mbp (207 bp) score=10
OAN307_c41530 hypothetical protein OAN307:4.061..4.061 Mbp (300 bp) score=10
OAN307_c41570 hypothetical protein OAN307:4.064..4.065 Mbp (402 bp) score=10
OAN307_c41620 hypothetical protein OAN307:4.071..4.071 Mbp (384 bp) score=10
OAN307_c41640 hypothetical protein OAN307:4.073..4.074 Mbp (837 bp) score=10
OAN307_c41670 hypothetical protein OAN307:4.076..4.076 Mbp (327 bp) score=10
OAN307_c41690 hypothetical protein OAN307:4.076..4.077 Mbp (462 bp) score=10
OAN307_c41730 hypothetical protein OAN307:4.082..4.082 Mbp (330 bp) score=10
OAN307_c41900 hypothetical protein OAN307:4.101..4.101 Mbp (285 bp) score=10
OAN307_c42110 hypothetical protein OAN307:4.126..4.127 Mbp (1.164 kbp) score=10
OAN307_c42120 hypothetical protein OAN307:4.127..4.128 Mbp (747 bp) score=10
OAN307_c42160 hypothetical protein OAN307:4.133..4.134 Mbp (486 bp) score=10
OAN307_c42180 hypothetical protein OAN307:4.135..4.136 Mbp (678 bp) score=10
OAN307_c42190 hypothetical protein OAN307:4.136..4.137 Mbp (1.221 kbp) score=10
OAN307_c42220 hypothetical protein OAN307:4.14..4.141 Mbp (513 bp) score=10
OAN307_c42290 hypothetical protein OAN307:4.146..4.147 Mbp (483 bp) score=10
OAN307_c42310 hypothetical protein OAN307:4.148..4.149 Mbp (672 bp) score=10
OAN307_c42370 hypothetical protein OAN307:4.157..4.158 Mbp (456 bp) score=10
OAN307_c42530 hypothetical protein OAN307:4.175..4.176 Mbp (765 bp) score=10
OAN307_c42650 hypothetical protein OAN307:4.188..4.188 Mbp (273 bp) score=10
OAN307_c42750 hypothetical protein OAN307:4.197..4.202 Mbp (5.382 kbp) score=10
OAN307_c42760 hypothetical protein OAN307:4.202..4.203 Mbp (720 bp) score=10
OAN307_c42780 hypothetical protein; transposase(fragment)-like OAN307:4.204..4.205 Mbp (428 bp) score=10
OAN307_c42800 hypothetical protein OAN307:4.205..4.208 Mbp (2.715 kbp) score=10
OAN307_c42840 hypothetical protein; transposase(fragment)-like OAN307:4.212..4.213 Mbp (480 bp) score=10
OAN307_c42870 hypothetical protein OAN307:4.215..4.215 Mbp (231 bp) score=10
OAN307_c42880 hypothetical protein OAN307:4.216..4.217 Mbp (924 bp) score=10
OAN307_c42910 hypothetical protein OAN307:4.221..4.222 Mbp (636 bp) score=10
OAN307_c42930 hypothetical protein OAN307:4.223..4.223 Mbp (546 bp) score=10
OAN307_c42940 hypothetical protein OAN307:4.223..4.224 Mbp (234 bp) score=10
OAN307_c42960 hypothetical protein OAN307:4.225..4.226 Mbp (495 bp) score=10
OAN307_c43070 hypothetical protein OAN307:4.24..4.24 Mbp (339 bp) score=10
OAN307_c43080 hypothetical protein OAN307:4.24..4.241 Mbp (666 bp) score=10
OAN307_c43090 hypothetical protein OAN307:4.241..4.241 Mbp (345 bp) score=10
OAN307_c43160 hypothetical protein OAN307:4.25..4.251 Mbp (282 bp) score=10
OAN307_c43170 hypothetical protein OAN307:4.251..4.251 Mbp (486 bp) score=10
OAN307_c43190 hypothetical protein; transposase(fragment)-like OAN307:4.253..4.253 Mbp (198 bp) score=10
OAN307_c43200 hypothetical protein; transposase(fragment)-like OAN307:4.253..4.254 Mbp (471 bp) score=10
OAN307_c43350 hypothetical protein OAN307:4.27..4.271 Mbp (531 bp) score=10
OAN307_c43490 hypothetical protein OAN307:4.285..4.288 Mbp (2.892 kbp) score=10
OAN307_c43540 hypothetical protein OAN307:4.292..4.293 Mbp (921 bp) score=10
OAN307_c43590 hypothetical protein OAN307:4.298..4.298 Mbp (201 bp) score=10
OAN307_c43710 hypothetical protein OAN307:4.308..4.309 Mbp (753 bp) score=10
OAN307_c43730 hypothetical protein OAN307:4.31..4.311 Mbp (663 bp) score=10
ttcA tRNA 2-thiocytidine biosynthesis protein ttcA; interrupted by pointmutation OAN307:4.311..4.311 Mbp (606 bp) score=10
OAN307_c43810 hypothetical protein OAN307:4.317..4.318 Mbp (615 bp) score=10
OAN307_c43980 hypothetical protein OAN307:4.333..4.334 Mbp (270 bp) score=10
OAN307_c44130 hypothetical protein OAN307:4.341..4.341 Mbp (609 bp) score=10
OAN307_c44140 hypothetical protein OAN307:4.342..4.342 Mbp (711 bp) score=10
OAN307_c44150 hypothetical protein OAN307:4.343..4.343 Mbp (234 bp) score=10
OAN307_c44220 hypothetical protein OAN307:4.348..4.349 Mbp (990 bp) score=10
OAN307_c44230 hypothetical protein OAN307:4.349..4.351 Mbp (1.425 kbp) score=10
OAN307_c44370 hypothetical protein OAN307:4.361..4.362 Mbp (903 bp) score=10
OAN307_c44420 hypothetical protein; transposase(fragment)-like OAN307:4.372..4.372 Mbp (219 bp) score=10
OAN307_c44430 hypothetical protein; sulfotransferase(fragment)-like OAN307:4.372..4.373 Mbp (369 bp) score=10
OAN307_c44440 hypothetical protein; transposase(fragment)-like OAN307:4.373..4.373 Mbp (150 bp) score=10
OAN307_c44450 hypothetical protein OAN307:4.373..4.374 Mbp (375 bp) score=10
OAN307_c44520 hypothetical protein OAN307:4.378..4.378 Mbp (342 bp) score=10
OAN307_c44530 hypothetical protein OAN307:4.379..4.379 Mbp (474 bp) score=10
OAN307_c44570 hypothetical protein OAN307:4.383..4.383 Mbp (372 bp) score=10
OAN307_c44590 hypothetical protein OAN307:4.386..4.386 Mbp (396 bp) score=10
OAN307_c44610 hypothetical protein OAN307:4.387..4.388 Mbp (822 bp) score=10
OAN307_c44620 hypothetical protein; integrase(fragment)-like OAN307:4.388..4.389 Mbp (831 bp) score=10
OAN307_c44650 hypothetical protein OAN307:4.39..4.391 Mbp (240 bp) score=10
OAN307_c44700 hypothetical protein OAN307:4.394..4.395 Mbp (330 bp) score=10
OAN307_c44710 hypothetical protein OAN307:4.395..4.395 Mbp (183 bp) score=10
OAN307_c44720 hypothetical protein OAN307:4.395..4.396 Mbp (573 bp) score=10
OAN307_c44730 hypothetical protein OAN307:4.396..4.397 Mbp (771 bp) score=10
OAN307_c44780 hypothetical protein DUF1111 OAN307:4.402..4.404 Mbp (1.536 kbp) score=10
OAN307_c44800 hypothetical protein OAN307:4.405..4.405 Mbp (495 bp) score=10
OAN307_c44820 hypothetical protein OAN307:4.407..4.407 Mbp (270 bp) score=10
OAN307_c44840 hypothetical protein OAN307:4.408..4.408 Mbp (429 bp) score=10
OAN307_c44940 hypothetical protein OAN307:4.417..4.418 Mbp (936 bp) score=10
OAN307_c44950 hypothetical protein OAN307:4.418..4.418 Mbp (351 bp) score=10
OAN307_c44960 hypothetical protein OAN307:4.418..4.419 Mbp (489 bp) score=10
OAN307_c44970 hypothetical protein OAN307:4.419..4.419 Mbp (225 bp) score=10
OAN307_c44980 hypothetical protein OAN307:4.419..4.419 Mbp (501 bp) score=10
OAN307_c45000 hypothetical protein OAN307:4.421..4.423 Mbp (1.962 kbp) score=10
OAN307_c45030 hypothetical protein OAN307:4.428..4.431 Mbp (2.4 kbp) score=10
OAN307_c45040 hypothetical protein OAN307:4.431..4.431 Mbp (444 bp) score=10
OAN307_c45070 hypothetical protein OAN307:4.435..4.435 Mbp (276 bp) score=10
OAN307_c45080 hypothetical protein DUF393 OAN307:4.435..4.436 Mbp (387 bp) score=10
OAN307_c45090 hypothetical protein OAN307:4.436..4.437 Mbp (1.218 kbp) score=10
OAN307_c45100 hypothetical protein OAN307:4.437..4.438 Mbp (945 bp) score=10
OAN307_c45110 hypothetical protein OAN307:4.438..4.439 Mbp (810 bp) score=10
OAN307_c45130 hypothetical protein OAN307:4.44..4.441 Mbp (483 bp) score=10
OAN307_c45140 hypothetical protein OAN307:4.441..4.441 Mbp (282 bp) score=10
OAN307_c45160 hypothetical protein OAN307:4.442..4.442 Mbp (339 bp) score=10
OAN307_c45170 hypothetical protein OAN307:4.442..4.443 Mbp (396 bp) score=10
OAN307_c45190 hypothetical protein OAN307:4.443..4.443 Mbp (213 bp) score=10
OAN307_c45200 hypothetical protein OAN307:4.444..4.444 Mbp (339 bp) score=10
OAN307_c45260 hypothetical protein OAN307:4.449..4.449 Mbp (300 bp) score=10
OAN307_c45270 hypothetical protein OAN307:4.449..4.45 Mbp (456 bp) score=10
OAN307_c45290 hypothetical protein OAN307:4.451..4.452 Mbp (444 bp) score=10
OAN307_c45310 hypothetical protein OAN307:4.453..4.453 Mbp (321 bp) score=10
OAN307_c45320 hypothetical protein OAN307:4.453..4.455 Mbp (1.218 kbp) score=10
OAN307_c45330 hypothetical protein OAN307:4.455..4.455 Mbp (321 bp) score=10
OAN307_c45350 polyprenyl synthetase OAN307:4.456..4.457 Mbp (852 bp) score=10
OAN307_c45400 hypothetical protein OAN307:4.461..4.462 Mbp (198 bp) score=10
OAN307_c45440 hypothetical protein; transposase(fragment)-like OAN307:4.467..4.468 Mbp (360 bp) score=10
OAN307_c45460 hypothetical protein OAN307:4.469..4.469 Mbp (282 bp) score=10
OAN307_c45470 hypothetical protein OAN307:4.469..4.47 Mbp (315 bp) score=10
OAN307_c45490 hypothetical protein OAN307:4.472..4.473 Mbp (1.305 kbp) score=10
OAN307_c45530 hypothetical protein OAN307:4.478..4.48 Mbp (2.007 kbp) score=10
OAN307_c45600 hypothetical protein OAN307:4.485..4.486 Mbp (978 bp) score=10
OAN307_c45630 hypothetical protein OAN307:4.489..4.49 Mbp (735 bp) score=10
mtgA monofunctional biosynthetic peptidoglycan transglycosylase MtgA OAN307:4.494..4.495 Mbp (768 bp) score=10
OAN307_c45770 hypothetical protein OAN307:4.506..4.507 Mbp (858 bp) score=10
OAN307_c45850 hypothetical protein OAN307:4.511..4.511 Mbp (246 bp) score=10
OAN307_c45910 hypothetical protein OAN307:4.515..4.516 Mbp (372 bp) score=10
OAN307_c45940 hypothetical protein OAN307:4.518..4.519 Mbp (1.215 kbp) score=10
OAN307_c45950 hypothetical protein OAN307:4.52..4.521 Mbp (1.425 kbp) score=10
OAN307_c45960 hypothetical protein OAN307:4.522..4.524 Mbp (1.692 kbp) score=10
OAN307_c45990 hypothetical protein OAN307:4.526..4.527 Mbp (1.239 kbp) score=10
OAN307_c46000 hypothetical protein DUF1365 OAN307:4.527..4.528 Mbp (756 bp) score=10
OAN307_c46010 hypothetical protein OAN307:4.528..4.529 Mbp (1.299 kbp) score=10
OAN307_c46040 hypothetical protein OAN307:4.531..4.531 Mbp (360 bp) score=10
OAN307_c46050 hypothetical protein OAN307:4.531..4.531 Mbp (321 bp) score=10
OAN307_c46090 hypothetical protein OAN307:4.536..4.536 Mbp (501 bp) score=10
purH bifunctional purine biosynthesis protein PurH OAN307:4.537..4.539 Mbp (1.59 kbp) score=10
OAN307_c46120 hypothetical protein OAN307:4.539..4.54 Mbp (1.77 kbp) score=10
OAN307_c46140 hypothetical protein DUF1674 OAN307:4.542..4.542 Mbp (177 bp) score=10
OAN307_c46150 hypothetical protein OAN307:4.542..4.542 Mbp (360 bp) score=10
OAN307_c46180 hypothetical protein DUF2233 OAN307:4.544..4.544 Mbp (717 bp) score=10
OAN307_c46200 hypothetical protein OAN307:4.546..4.546 Mbp (369 bp) score=10
OAN307_c46210 hypothetical protein DUF1643 OAN307:4.546..4.546 Mbp (540 bp) score=10
OAN307_c46260 hypothetical protein OAN307:4.552..4.553 Mbp (555 bp) score=10
OAN307_c46340 hypothetical protein OAN307:4.561..4.562 Mbp (624 bp) score=10
OAN307_c46360 hypothetical protein OAN307:4.562..4.563 Mbp (159 bp) score=10
OAN307_c46370 hypothetical protein; transposase(fragment)-like OAN307:4.563..4.564 Mbp (824 bp) score=10
OAN307_c46380 hypothetical protein OAN307:4.564..4.564 Mbp (282 bp) score=10
OAN307_c46390 hypothetical protein OAN307:4.564..4.565 Mbp (381 bp) score=10
OAN307_c46420 hypothetical protein OAN307:4.567..4.567 Mbp (591 bp) score=10
OAN307_c46470 hypothetical protein OAN307:4.57..4.571 Mbp (1.422 kbp) score=10
OAN307_c46480 hypothetical protein OAN307:4.571..4.573 Mbp (1.695 kbp) score=10
OAN307_c46490 hypothetical protein OAN307:4.573..4.574 Mbp (1.113 kbp) score=10
OAN307_c46500 hypothetical protein OAN307:4.574..4.575 Mbp (1.065 kbp) score=10
OAN307_c46590 hypothetical protein DUF2466 OAN307:4.584..4.585 Mbp (801 bp) score=10
OAN307_c46610 hypothetical protein OAN307:4.586..4.587 Mbp (1.101 kbp) score=10
argJ arginine biosynthesis bifunctional protein ArgJ OAN307:4.591..4.593 Mbp (1.215 kbp) score=10
OAN307_c46660 hypothetical protein OAN307:4.593..4.593 Mbp (195 bp) score=10
OAN307_c46680 hypothetical protein DUF448 OAN307:4.596..4.596 Mbp (633 bp) score=10
OAN307_c46700 hypothetical protein UPF9 OAN307:4.598..4.599 Mbp (594 bp) score=10
OAN307_c46810 hypothetical protein OAN307:4.609..4.61 Mbp (831 bp) score=10
OAN307_c46830 hypothetical protein OAN307:4.611..4.611 Mbp (369 bp) score=10
OAN307_c46840 hypothetical protein OAN307:4.612..4.612 Mbp (645 bp) score=10
OAN307_c46850 hypothetical protein OAN307:4.613..4.613 Mbp (681 bp) score=10
OAN307_c46860 hypothetical protein OAN307:4.613..4.614 Mbp (492 bp) score=10
OAN307_c46870 hypothetical protein OAN307:4.614..4.615 Mbp (1.203 kbp) score=10
OAN307_c46920 hypothetical protein; transposase(fragment)-like OAN307:4.62..4.62 Mbp (360 bp) score=10
OAN307_c46930 hypothetical protein OAN307:4.621..4.621 Mbp (336 bp) score=10
OAN307_c46940 hypothetical protein OAN307:4.621..4.621 Mbp (390 bp) score=10
OAN307_c46950 hypothetical protein; transposase(fragment)-like OAN307:4.622..4.622 Mbp (546 bp) score=10
OAN307_c46970 hypothetical protein OAN307:4.623..4.624 Mbp (690 bp) score=10
OAN307_c47020 hypothetical protein OAN307:4.627..4.629 Mbp (1.155 kbp) score=10
OAN307_c47070 hypothetical protein OAN307:4.634..4.635 Mbp (705 bp) score=10
OAN307_c47080 hypothetical protein OAN307:4.634..4.635 Mbp (282 bp) score=10
OAN307_c47090 hypothetical protein OAN307:4.635..4.635 Mbp (441 bp) score=10
OAN307_c47150 hypothetical protein DUF721 OAN307:4.641..4.642 Mbp (516 bp) score=10
OAN307_c47160 hypothetical protein OAN307:4.642..4.642 Mbp (669 bp) score=10
OAN307_c47200 hypothetical protein OAN307:4.646..4.646 Mbp (243 bp) score=10
OAN307_c47230 hypothetical protein OAN307:4.648..4.65 Mbp (1.503 kbp) score=10
OAN307_c47240 hypothetical protein OAN307:4.65..4.651 Mbp (1.506 kbp) score=10
OAN307_c47270 hypothetical protein OAN307:4.653..4.653 Mbp (297 bp) score=10
OAN307_c47280 hypothetical protein OAN307:4.653..4.654 Mbp (1.176 kbp) score=10
OAN307_c47310 putative exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase OAN307:4.657..4.657 Mbp (606 bp) score=10
OAN307_c47350 hypothetical protein OAN307:4.662..4.663 Mbp (1.029 kbp) score=10
OAN307_c47360 hypothetical protein DUF2159 OAN307:4.663..4.663 Mbp (501 bp) score=10
leuS leucyl-tRNA synthetase LeuS OAN307:4.663..4.666 Mbp (2.556 kbp) score=10
OAN307_c47380 hypothetical protein OAN307:4.666..4.666 Mbp (486 bp) score=10
OAN307_c47400 hypothetical protein OAN307:4.668..4.668 Mbp (654 bp) score=10
OAN307_c47410 hypothetical protein OAN307:4.668..4.669 Mbp (495 bp) score=10
OAN307_c47470 hypothetical protein OAN307:4.674..4.675 Mbp (912 bp) score=10
OAN307_c47550 hypothetical protein OAN307:4.686..4.686 Mbp (588 bp) score=10
OAN307_c47570 hypothetical protein OAN307:4.687..4.687 Mbp (195 bp) score=10
OAN307_c47600 hypothetical protein OAN307:4.689..4.689 Mbp (159 bp) score=10
OAN307_c47620 hypothetical protein OAN307:4.689..4.69 Mbp (1.473 kbp) score=10
OAN307_c47630 hypothetical protein OAN307:4.69..4.692 Mbp (1.323 kbp) score=10
OAN307_c47640 hypothetical protein OAN307:4.692..4.692 Mbp (690 bp) score=10
OAN307_c47680 hypothetical protein DUF55 OAN307:4.695..4.695 Mbp (420 bp) score=10
OAN307_c47690 hypothetical protein OAN307:4.695..4.696 Mbp (393 bp) score=10
OAN307_c47750 hypothetical protein OAN307:4.702..4.703 Mbp (543 bp) score=10
OAN307_c47780 hypothetical protein DUF328 OAN307:4.705..4.706 Mbp (783 bp) score=10
OAN307_c47810 hypothetical protein DUF214 OAN307:4.708..4.71 Mbp (2.334 kbp) score=10
OAN307_c47820 hypothetical protein DUF26 OAN307:4.71..4.711 Mbp (1.035 kbp) score=10
OAN307_c47850 hypothetical protein OAN307:4.715..4.715 Mbp (396 bp) score=10
OAN307_c48080 hypothetical protein OAN307:4.738..4.739 Mbp (660 bp) score=10
OAN307_c48100 hypothetical protein OAN307:4.74..4.74 Mbp (591 bp) score=10
OAN307_c48170 hypothetical protein OAN307:4.75..4.751 Mbp (684 bp) score=10
OAN307_c48180 hypothetical protein OAN307:4.751..4.752 Mbp (933 bp) score=10
OAN307_c48190 hypothetical protein UPF79 OAN307:4.752..4.752 Mbp (471 bp) score=10
regA photosynthetic apparatus regulatory protein RegA OAN307:4.756..4.757 Mbp (546 bp) score=10
OAN307_c48250 hypothetical protein OAN307:4.758..4.758 Mbp (165 bp) score=10
OAN307_c48260 hypothetical protein OAN307:4.758..4.759 Mbp (591 bp) score=10
OAN307_c48280 hypothetical protein OAN307:4.761..4.761 Mbp (342 bp) score=10
OAN307_c48610 hypothetical protein OAN307:4.794..4.795 Mbp (789 bp) score=10
OAN307_c48630 hypothetical protein OAN307:4.796..4.796 Mbp (405 bp) score=10
OAN307_c48640 hypothetical protein OAN307:4.796..4.797 Mbp (762 bp) score=10
OAN307_c48710 hypothetical protein OAN307:4.803..4.803 Mbp (273 bp) score=10
OAN307_c48720 hypothetical protein OAN307:4.803..4.805 Mbp (2.034 kbp) score=10
ubiB putative ubiquinone biosynthesis protein UbiB OAN307:4.806..4.808 Mbp (1.533 kbp) score=10
ubiE ubiquinone/menaquinone biosynthesis methyltransferase OAN307:4.808..4.808 Mbp (747 bp) score=10
OAN307_63p00050 hypothetical protein OAN307:4.819..4.819 Mbp (432 bp) score=10
OAN307_63p00280 hypothetical protein OAN307:4.843..4.843 Mbp (294 bp) score=10
OAN307_63p00410 hypothetical protein OAN307:4.856..4.857 Mbp (1.11 kbp) score=10
OAN307_63p00440 hypothetical protein OAN307:4.859..4.86 Mbp (336 bp) score=10
OAN307_63p00450 hypothetical protein OAN307:4.861..4.861 Mbp (303 bp) score=10
OAN307_63p00460 hypothetical protein OAN307:4.861..4.861 Mbp (324 bp) score=10
OAN307_63p00550 hypothetical protein OAN307:4.871..4.872 Mbp (483 bp) score=10
OAN307_63p00570 hypothetical protein OAN307:4.872..4.873 Mbp (285 bp) score=10
OAN307_63p00580 hypothetical protein OAN307:4.873..4.873 Mbp (441 bp) score=10
OAN307_63p00590 hypothetical protein; resolvase(fragment)-like OAN307:4.874..4.875 Mbp (321 bp) score=10
OAN307_63p00600 hypothetical protein OAN307:4.875..4.875 Mbp (453 bp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70