- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: RBY4I:500000..600000, RBY4I_3802, megL, ZP_05081088, transcriptional regulator, AAAADGTLAAFDILAAHAHRKGNLVTFHMTTNGGAGTEVPEA.

[Bookmark this] [Upload your own data] [Show banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
Reports & Analysis:
  
Data Source
The following 528 regions match your request.
Matches on RBY4I
overview_RBY4I
RBY4I_77 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RBY4I:8.725..9.183 kbp (459 bp) score=40
RBY4I_13 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:27.2..28.14 kbp (933 bp) score=40
RBY4I_61 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RBY4I:58.63..59.11 kbp (480 bp) score=40
RBY4I_20 transcriptional regulator, arac family, putative [K] COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain RBY4I:73.39..74.3 kbp (909 bp) score=40
RBY4I_140 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:122.4..123.3 kbp (903 bp) score=40
RBY4I_109 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RBY4I:149.9..150.2 kbp (252 bp) score=40
RBY4I_165 transcriptional regulator, RpiR family [K] COG1737 Transcriptional regulators RBY4I:165.9..166.8 kbp (912 bp) score=40
RBY4I_234 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:181.1..182 kbp (906 bp) score=40
RBY4I_229 transcriptional regulator [K] COG0583 Transcriptional regulator RBY4I:182..182.9 kbp (888 bp) score=40
RBY4I_226 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:198.1..199 kbp (918 bp) score=40
RBY4I_177 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:200.9..201.8 kbp (909 bp) score=40
RBY4I_213 transcriptional regulator, IclR family [K] COG1414 Transcriptional regulator RBY4I:211.1..211.9 kbp (834 bp) score=40
RBY4I_3522 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RBY4I:270.9..271.3 kbp (372 bp) score=40
RBY4I_616 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RBY4I:281.4..282.1 kbp (726 bp) score=40
RBY4I_3116 transcriptional regulator, DeoR family [KG] COG1349 Transcriptional regulators of sugar metabolism RBY4I:318.7..319.4 kbp (747 bp) score=40
RBY4I_1153 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RBY4I:395.7..396.2 kbp (504 bp) score=40
RBY4I_2201 transcriptional regulator, GntR family [K] COG2188 Transcriptional regulators RBY4I:400.9..401.6 kbp (702 bp) score=40
RBY4I_1993 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RBY4I:413.7..414.2 kbp (453 bp) score=40
RBY4I_3701 transcriptional regulatory protein [K] COG1733 Predicted transcriptional regulators RBY4I:417.5..417.9 kbp (378 bp) score=40
RBY4I_3698 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:445.9..446.8 kbp (897 bp) score=40
RBY4I_1164 transcriptional regulator [K] COG0583 Transcriptional regulator RBY4I:491.7..492.6 kbp (915 bp) score=40
RBY4I_1562 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RBY4I:497.8..498.3 kbp (564 bp) score=40
RBY4I_910 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RBY4I:521..521.5 kbp (597 bp) score=40
RBY4I_848 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:593.2..594.1 kbp (891 bp) score=40
RBY4I_1912 putative transcriptional regulator [K] COG1522 Transcriptional regulators RBY4I:603.1..603.6 kbp (471 bp) score=40
RBY4I_313 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RBY4I:613.8..614.4 kbp (597 bp) score=40
RBY4I_3794 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RBY4I:744.5..745.1 kbp (597 bp) score=40
RBY4I_1078 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RBY4I:752.9..753.6 kbp (648 bp) score=40
RBY4I_2015 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:766.4..767.4 kbp (972 bp) score=40
RBY4I_1401 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RBY4I:788..788.5 kbp (537 bp) score=40
RBY4I_3183 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RBY4I:788.6..789.3 kbp (669 bp) score=40
cueR Cu(I)-responsive transcriptional regulator [K] COG0789 Predicted transcriptional regulators RBY4I:813.2..813.6 kbp (390 bp) score=40
RBY4I_3408 beta-ketoadipate pathway transcriptional regulator, PcaR/PcaU/PobR family [K] COG1414 Transcriptional regulator RBY4I:907.7..908.5 kbp (777 bp) score=40
RBY4I_3373 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RBY4I:970.4..970.9 kbp (585 bp) score=40
RBY4I_3778 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RBY4I:974.3..974.9 kbp (621 bp) score=40
RBY4I_3850 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators; overlaps another CDS with the same product name RBY4I:1.017..1.018 Mbp (456 bp) score=40
RBY4I_3645 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators; overlaps another CDS with the same product name RBY4I:1.018..1.018 Mbp (459 bp) score=40
RBY4I_2918 transcriptional regulator, GntR family [K] COG2186 Transcriptional regulators RBY4I:1.022..1.023 Mbp (645 bp) score=40
RBY4I_432 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RBY4I:1.042..1.042 Mbp (693 bp) score=40
RBY4I_3107 transcriptional regulator, DeoR family [KG] COG1349 Transcriptional regulators of sugar metabolism RBY4I:1.068..1.069 Mbp (786 bp) score=40
RBY4I_1939 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RBY4I:1.087..1.088 Mbp (864 bp) score=40
RBY4I_2780 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RBY4I:1.106..1.106 Mbp (618 bp) score=40
RBY4I_2324 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:1.111..1.112 Mbp (876 bp) score=40
nrdR transcriptional regulator NrdR [K] COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains RBY4I:1.132..1.133 Mbp (468 bp) score=40
RBY4I_586 transcriptional regulator, CarD family [K] COG1329 Transcriptional regulators, similar to M. xanthus CarD RBY4I:1.158..1.159 Mbp (510 bp) score=40
RBY4I_2707 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RBY4I:1.164..1.164 Mbp (456 bp) score=40
RBY4I_1545 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RBY4I:1.216..1.216 Mbp (240 bp) score=40
RBY4I_729 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RBY4I:1.245..1.245 Mbp (444 bp) score=40
RBY4I_3270 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RBY4I:1.292..1.293 Mbp (582 bp) score=40
RBY4I_2097 transcriptional regulator [K] COG0583 Transcriptional regulator RBY4I:1.373..1.374 Mbp (885 bp) score=40
RBY4I_358 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RBY4I:1.423..1.423 Mbp (468 bp) score=40
RBY4I_3641 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RBY4I:1.444..1.445 Mbp (456 bp) score=40
RBY4I_2499 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RBY4I:1.469..1.47 Mbp (759 bp) score=40
RBY4I_3506 transcriptional regulator, GntR family [K] COG2188 Transcriptional regulators RBY4I:1.703..1.705 Mbp (1.35 kbp) score=40
RBY4I_442 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RBY4I:1.708..1.709 Mbp (618 bp) score=40
RBY4I_3236 two component, sigma54 specific, transcriptional regulator, Fis family [KE] COG3283 Transcriptional regulator of aromatic amino acids metabolism RBY4I:1.733..1.735 Mbp (1.368 kbp) score=40
RBY4I_2238 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RBY4I:1.762..1.762 Mbp (624 bp) score=40
RBY4I_2835 transcriptional regulator/arsenate reductase [K] COG0640 Predicted transcriptional regulators RBY4I:1.764..1.765 Mbp (834 bp) score=40
RBY4I_3638 transcriptional regulator, BadM/Rrf2 family [K] COG1959 Predicted transcriptional regulator RBY4I:1.809..1.809 Mbp (429 bp) score=40
RBY4I_3955 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:1.819..1.82 Mbp (870 bp) score=40
RBY4I_245 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:1.853..1.854 Mbp (912 bp) score=40
RBY4I_1899 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RBY4I:1.871..1.871 Mbp (426 bp) score=40
RBY4I_2747 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:1.953..1.954 Mbp (906 bp) score=40
RBY4I_1155 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:1.967..1.968 Mbp (897 bp) score=40
RBY4I_1640 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RBY4I:1.979..1.98 Mbp (792 bp) score=40
RBY4I_2422 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RBY4I:2.205..2.206 Mbp (669 bp) score=40
RBY4I_2580 transcriptional regulator, XRE family [R] COG3800 Predicted transcriptional regulator RBY4I:2.224..2.226 Mbp (1.299 kbp) score=40
RBY4I_3763 transcriptional regulator SoxR [K] COG0640 Predicted transcriptional regulators RBY4I:2.253..2.253 Mbp (339 bp) score=40
RBY4I_2342 transcriptional regulatory protein [K] COG1846 Transcriptional regulators RBY4I:2.277..2.277 Mbp (273 bp) score=40
RBY4I_1251 transcriptional regulator, MerR family [K] COG0789 Predicted transcriptional regulators RBY4I:2.286..2.287 Mbp (369 bp) score=40
RBY4I_291 transcriptional regulator, MerR family [K] COG0789 Predicted transcriptional regulators RBY4I:2.287..2.287 Mbp (402 bp) score=40
RBY4I_674 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:2.323..2.323 Mbp (882 bp) score=40
RBY4I_509 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:2.338..2.339 Mbp (906 bp) score=40
RBY4I_1441 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RBY4I:2.346..2.346 Mbp (438 bp) score=40
RBY4I_1992 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:2.384..2.385 Mbp (924 bp) score=40
RBY4I_2155 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RBY4I:2.386..2.386 Mbp (453 bp) score=40
RBY4I_3085 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RBY4I:2.387..2.387 Mbp (333 bp) score=40
RBY4I_1621 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RBY4I:2.442..2.443 Mbp (1.389 kbp) score=40
RBY4I_1270 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RBY4I:2.47..2.47 Mbp (372 bp) score=40
RBY4I_2820 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:2.471..2.472 Mbp (882 bp) score=40
RBY4I_967 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RBY4I:2.51..2.511 Mbp (453 bp) score=40
RBY4I_2906 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:2.587..2.588 Mbp (966 bp) score=40
RBY4I_2160 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:2.607..2.608 Mbp (897 bp) score=40
RBY4I_2122 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RBY4I:2.679..2.68 Mbp (501 bp) score=40
RBY4I_2284 transcriptional regulator, MerR family [K] COG0789 Predicted transcriptional regulators RBY4I:2.717..2.717 Mbp (402 bp) score=40
RBY4I_2784 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RBY4I:2.744..2.744 Mbp (462 bp) score=40
RBY4I_1176 transcriptional regulatory protein [K] COG0583 Transcriptional regulator RBY4I:2.747..2.748 Mbp (918 bp) score=40
RBY4I_388 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:2.763..2.764 Mbp (888 bp) score=40
RBY4I_2574 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:2.827..2.827 Mbp (861 bp) score=40
RBY4I_3921 transcriptional regulator, RpiR family [K] COG1737 Transcriptional regulators RBY4I:2.852..2.853 Mbp (873 bp) score=40
RBY4I_1116 transcriptional regulator, LacI family [K] COG1609 Transcriptional regulators RBY4I:2.862..2.863 Mbp (1.005 kbp) score=40
RBY4I_3286 transcriptional regulator, IclR family [K] COG1414 Transcriptional regulator RBY4I:2.88..2.881 Mbp (780 bp) score=40
RBY4I_3289 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RBY4I:2.886..2.887 Mbp (651 bp) score=40
RBY4I_2292 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:2.968..2.969 Mbp (954 bp) score=40
RBY4I_2718 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:3.043..3.044 Mbp (804 bp) score=40
RBY4I_3003 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RBY4I:3.071..3.071 Mbp (609 bp) score=40
RBY4I_2984 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RBY4I:3.087..3.088 Mbp (459 bp) score=40
RBY4I_1167 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:3.095..3.095 Mbp (879 bp) score=40
RBY4I_3319 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RBY4I:3.116..3.116 Mbp (528 bp) score=40
RBY4I_3095 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RBY4I:3.119..3.12 Mbp (663 bp) score=40
RBY4I_1806 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:3.126..3.127 Mbp (930 bp) score=40
RBY4I_1972 transcriptional regulator, ArsR family [K] COG0640 Predicted transcriptional regulators RBY4I:3.14..3.141 Mbp (285 bp) score=40
RBY4I_2034 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RBY4I:3.145..3.146 Mbp (459 bp) score=40
RBY4I_3033 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RBY4I:3.149..3.15 Mbp (666 bp) score=40
phnF phosphonates metabolism transcriptional regulator PhnF [K] COG2186 Transcriptional regulators RBY4I:3.175..3.175 Mbp (714 bp) score=40
RBY4I_694 transcriptional regulator, ArsR family [K] COG0640 Predicted transcriptional regulators RBY4I:3.2..3.201 Mbp (312 bp) score=40
RBY4I_2966 transcriptional regulator, GntR family [K] COG1725 Predicted transcriptional regulators RBY4I:3.201..3.202 Mbp (1.461 kbp) score=40
RBY4I_925 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RBY4I:3.226..3.226 Mbp (531 bp) score=40
RBY4I_2794 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:3.232..3.233 Mbp (894 bp) score=40
RBY4I_3043 transcriptional regulator, XRE family [K] COG1396 Predicted transcriptional regulators RBY4I:3.261..3.262 Mbp (561 bp) score=40
RBY4I_1436 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:3.304..3.305 Mbp (921 bp) score=40
RBY4I_3385 transcriptional regulator, GntR family [KE] COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs RBY4I:3.312..3.313 Mbp (1.338 kbp) score=40
RBY4I_1238 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RBY4I:3.326..3.326 Mbp (420 bp) score=40
RBY4I_2037 two component, sigma54 specific, transcriptional regulator, Fis family [KT] COG1221 Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain RBY4I:3.327..3.329 Mbp (1.359 kbp) score=40
RBY4I_931 transcriptional regulator, ArsR family [K] COG0640 Predicted transcriptional regulators RBY4I:3.485..3.485 Mbp (345 bp) score=40
RBY4I_842 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:3.486..3.487 Mbp (879 bp) score=40
RBY4I_2842 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RBY4I:3.506..3.506 Mbp (441 bp) score=40
RBY4I_929 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RBY4I:3.522..3.523 Mbp (615 bp) score=40
RBY4I_1075 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:3.528..3.529 Mbp (909 bp) score=40
RBY4I_628 transcriptional regulator, HxlR family [K] COG1733 Predicted transcriptional regulators RBY4I:3.569..3.569 Mbp (210 bp) score=40
RBY4I_2407 transcriptional regulator, XRE family with cupin sensor [K] COG1396 Predicted transcriptional regulators RBY4I:3.682..3.682 Mbp (567 bp) score=40
RBY4I_1908 transcriptional regulator, ArsR family [K] COG0640 Predicted transcriptional regulators RBY4I:3.691..3.692 Mbp (321 bp) score=40
RBY4I_3090 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RBY4I:3.7..3.7 Mbp (600 bp) score=40
RBY4I_2236 transcriptional regulator, GntR family [K] COG1802 Transcriptional regulators RBY4I:3.72..3.721 Mbp (687 bp) score=40
RBY4I_1698 transcriptional regulator, LacI family [K] COG1609 Transcriptional regulators RBY4I:3.766..3.767 Mbp (1.026 kbp) score=40
RBY4I_3625 transcriptional regulator, MerR family [K] COG0789 Predicted transcriptional regulators RBY4I:3.795..3.796 Mbp (417 bp) score=40
RBY4I_1144 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:3.8..3.8 Mbp (177 bp) score=40
RBY4I_2439 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:3.8..3.801 Mbp (564 bp) score=40
RBY4I_1246 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RBY4I:3.804..3.805 Mbp (513 bp) score=40
RBY4I_884 transcriptional regulator, MarR family [K] COG1846 Transcriptional regulators RBY4I:3.924..3.924 Mbp (441 bp) score=40
RBY4I_3478 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RBY4I:4.048..4.049 Mbp (594 bp) score=40
RBY4I_3393 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RBY4I:4.164..4.165 Mbp (618 bp) score=40
RBY4I_2019 transcriptional regulator, ArsR family [K] COG0640 Predicted transcriptional regulators RBY4I:4.166..4.166 Mbp (690 bp) score=40
RBY4I_4160 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:4.182..4.183 Mbp (918 bp) score=40
RBY4I_4093 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:4.203..4.204 Mbp (915 bp) score=40
RBY4I_4178 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:4.213..4.214 Mbp (885 bp) score=40
RBY4I_4106 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:4.224..4.225 Mbp (1.014 kbp) score=40
RBY4I_4161 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:4.235..4.236 Mbp (924 bp) score=40
RBY4I_4125 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:4.239..4.24 Mbp (900 bp) score=40
RBY4I_4181 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:4.261..4.262 Mbp (936 bp) score=40
RBY4I_4201 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RBY4I:4.262..4.262 Mbp (498 bp) score=40
RBY4I_4083 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:4.271..4.272 Mbp (891 bp) score=40
RBY4I_4095 transcriptional regulator, LacI family [K] COG1609 Transcriptional regulators RBY4I:4.276..4.277 Mbp (1.029 kbp) score=40
RBY4I_4164 transcriptional regulator, TetR family [K] COG1309 Transcriptional regulator RBY4I:4.303..4.303 Mbp (633 bp) score=40
RBY4I_4204 transcriptional regulator, AsnC family [K] COG1522 Transcriptional regulators RBY4I:4.303..4.304 Mbp (465 bp) score=40
RBY4I_4182 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:4.324..4.325 Mbp (888 bp) score=40
RBY4I_4068 transcriptional regulator, LysR family [K] COG0583 Transcriptional regulator RBY4I:4.34..4.341 Mbp (975 bp) score=40
RBY4I_73 two component transcriptional regulator, winged helix family [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RBY4I:43.47..44.2 kbp (735 bp) score=30
RBY4I_98 transcriptional regulator, Crp/Fnr family, putative [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RBY4I:106..106.7 kbp (753 bp) score=30
RBY4I_2164 transcriptional regulator, AlpA family [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:513..513.2 kbp (207 bp) score=30
RBY4I_2458 two component transcriptional regulator, winged helix family [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RBY4I:731.4..732.1 kbp (723 bp) score=30
RBY4I_1810 transcriptional repressor, CopY family [K] COG3682 Predicted transcriptional regulator RBY4I:858.3..858.7 kbp (417 bp) score=30
RBY4I_2112 two component, sigma54 specific, transcriptional regulator, Fis family [T] COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RBY4I:1.426..1.427 Mbp (1.23 kbp) score=30
RBY4I_310 transcriptional regulator, MerR family [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.518..1.52 Mbp (1.608 kbp) score=30
RBY4I_844 two component transcriptional regulator, LuxR family [TK] COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain RBY4I:1.571..1.571 Mbp (717 bp) score=30
RBY4I_2131 two component, sigma54 specific, transcriptional regulator, Fis family [T] COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RBY4I:1.607..1.608 Mbp (1.338 kbp) score=30
RBY4I_479 regulatory protein GntR, HTH [K] COG2186 Transcriptional regulators RBY4I:1.622..1.623 Mbp (729 bp) score=30
RBY4I_1388 transcriptional regulator, AraC family [T] COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain RBY4I:1.673..1.674 Mbp (813 bp) score=30
RBY4I_2641 two component transcriptional regulator, winged helix family [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RBY4I:1.689..1.69 Mbp (720 bp) score=30
RBY4I_2020 two component, sigma54 specific, transcriptional regulator, Fis family [T] COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains RBY4I:1.737..1.738 Mbp (1.41 kbp) score=30
phoB phosphate regulon transcriptional regulatory protein PhoB [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RBY4I:1.852..1.853 Mbp (690 bp) score=30
RBY4I_896 transcriptional regulator, LuxR family [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RBY4I:1.909..1.91 Mbp (756 bp) score=30
RBY4I_3012 transcriptional regulator, Crp-Fnr family [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RBY4I:2.012..2.012 Mbp (606 bp) score=30
RBY4I_1645 transcriptional regulator, LuxR family [T] COG4566 Response regulator RBY4I:2.234..2.235 Mbp (537 bp) score=30
putR proline dehydrogenase transcriptional activator [K] COG1522 Transcriptional regulators RBY4I:2.33..2.331 Mbp (471 bp) score=30
betI transcriptional repressor BetI [K] COG1309 Transcriptional regulator RBY4I:2.452..2.452 Mbp (594 bp) score=30
RBY4I_2767 transcription regulator, TetR family [K] COG1309 Transcriptional regulator RBY4I:2.481..2.482 Mbp (582 bp) score=30
RBY4I_3541 transcriptional regulator, Crp/Fnr family [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RBY4I:2.536..2.537 Mbp (669 bp) score=30
soxR redox-sensitive transcriptional activator SoxR [K] COG0789 Predicted transcriptional regulators RBY4I:2.978..2.978 Mbp (480 bp) score=30
RBY4I_2626 two component transcriptional regulator, winged helix family [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RBY4I:4.018..4.019 Mbp (687 bp) score=30
RBY4I_68 transcriptional regulator, GntR family RBY4I:67.6..69 kbp (1.395 kbp) score=20
RBY4I_41 transcriptional regulator, arac family, putative RBY4I:82.64..83.69 kbp (1.05 kbp) score=20
RBY4I_135 [K] COG1475 Predicted transcriptional regulators RBY4I:142.7..143.7 kbp (1.017 kbp) score=20
RBY4I_153 [K] COG1475 Predicted transcriptional regulators RBY4I:160.3..161.4 kbp (1.128 kbp) score=20
RBY4I_202 [K] COG3609 Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain RBY4I:167.1..167.4 kbp (228 bp) score=20
RBY4I_186 two-component response regulator [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RBY4I:188.1..188.8 kbp (672 bp) score=20
RBY4I_155 response regulator receiver protein [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RBY4I:220.4..220.8 kbp (375 bp) score=20
RBY4I_185 response regulator receiver protein [T] COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain RBY4I:224.3..224.7 kbp (387 bp) score=20
RBY4I_2254 transcriptional regulator, AraC family RBY4I:277.4..278.4 kbp (1.005 kbp) score=20
RBY4I_2551 [K] COG1396 Predicted transcriptional regulators RBY4I:288..288.7 kbp (657 bp) score=20
RBY4I_3960 nitrate/nitrite response regulator protein, putative [TK] COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain RBY4I:309.1..309.7 kbp (615 bp) score=20
RBY4I_3792 DNA-binding response regulator, LuxR family [TK] COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain RBY4I:371..371.7 kbp (696 bp) score=20
RBY4I_349 two-component response regulator [TK] COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain RBY4I:409.9..410.8 kbp (816 bp) score=20
RBY4I_2680 Crp-Fnr family transciptional regulator [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RBY4I:412..412.6 kbp (681 bp) score=20
RBY4I_472 DNA-binding response regulator [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RBY4I:442.8..443.5 kbp (666 bp) score=20
hutC [K] COG2188 Transcriptional regulators RBY4I:462.8..463.5 kbp (723 bp) score=20
RBY4I_1437 [K] COG0583 Transcriptional regulator RBY4I:533.1..533.5 kbp (375 bp) score=20
RBY4I_2548 transcriptional regulator, GntR family RBY4I:561.1..562.5 kbp (1.377 kbp) score=20
RBY4I_3230 [K] COG1733 Predicted transcriptional regulators; helix-turn-helix, HxlR type RBY4I:658.9..659.6 kbp (729 bp) score=20
RBY4I_3775 transcriptional regulator, LuxR family RBY4I:668.3..669.4 kbp (1.083 kbp) score=20
RBY4I_3846 transcriptional regulator, AraC family RBY4I:778.4..779.4 kbp (1.008 kbp) score=20
RBY4I_1274 response regulator receiver domain protein [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RBY4I:791.1..791.8 kbp (732 bp) score=20
pcaQ [K] COG0583 Transcriptional regulator RBY4I:816.4..817.3 kbp (927 bp) score=20
RBY4I_607 transcriptional regulator, sarp family RBY4I:822..823.7 kbp (1.659 kbp) score=20
RBY4I_1474 Crp-Fnr regulatory protein [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RBY4I:849.2..849.9 kbp (696 bp) score=20
RBY4I_1438 transcriptional regulator, AraC family RBY4I:869.7..870.7 kbp (1.017 kbp) score=20
RBY4I_1147 transcriptional regulator, AraC family RBY4I:1.082..1.083 Mbp (984 bp) score=20
RBY4I_3922 transcriptional regulator, AraC family RBY4I:1.214..1.214 Mbp (732 bp) score=20
RBY4I_3500 transcriptional regulator, XRE family RBY4I:1.287..1.288 Mbp (657 bp) score=20
RBY4I_1045 [K] COG1521 Putative transcriptional regulator, homolog of Bvg accessory factor RBY4I:1.354..1.355 Mbp (783 bp) score=20
RBY4I_334 [K] COG2378 Predicted transcriptional regulator; helix-turn-helix, type 11 RBY4I:1.37..1.37 Mbp (675 bp) score=20
narL two component response regulator [NT] COG2201 Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain RBY4I:1.476..1.477 Mbp (645 bp) score=20
RBY4I_548 transcriptional regulator, AraC family RBY4I:1.839..1.84 Mbp (1.005 kbp) score=20
RBY4I_2737 [KE] COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs RBY4I:1.922..1.923 Mbp (1.176 kbp) score=20
RBY4I_1881 [K] COG5007 Predicted transcriptional regulator, BolA superfamily RBY4I:1.957..1.957 Mbp (237 bp) score=20
RBY4I_1272 [K] COG1737 Transcriptional regulators RBY4I:2.178..2.179 Mbp (801 bp) score=20
RBY4I_3187 [K] COG0583 Transcriptional regulator RBY4I:2.23..2.23 Mbp (756 bp) score=20
RBY4I_1095 transcriptional regulator, LuxR family RBY4I:2.232..2.233 Mbp (549 bp) score=20
RBY4I_2735 transcriptional regulator, AraC family RBY4I:2.242..2.243 Mbp (1.008 kbp) score=20
RBY4I_3122 [K] COG0583 Transcriptional regulator RBY4I:2.456..2.457 Mbp (885 bp) score=20
RBY4I_640 N-acetylmuramyl-L-alanine amidase, negative regulator of AmpC, AmpD [V] COG3023 Negative regulator of beta-lactamase expression RBY4I:2.476..2.476 Mbp (696 bp) score=20
RBY4I_3218 transcriptional regulator, MocR family RBY4I:2.561..2.562 Mbp (1.371 kbp) score=20
RBY4I_3598 [KE] COG1167 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs RBY4I:2.565..2.567 Mbp (1.113 kbp) score=20
RBY4I_3007 transcriptional regulator, TraR/DksA family RBY4I:2.58..2.581 Mbp (327 bp) score=20
RBY4I_3027 GcrA cell cycle regulator [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.617..2.618 Mbp (342 bp) score=20
RBY4I_3084 transcriptional regulator, AraC family RBY4I:2.618..2.619 Mbp (1.011 kbp) score=20
RBY4I_1603 response regulator [TK] COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain RBY4I:2.655..2.655 Mbp (720 bp) score=20
RBY4I_900 transcriptional regulator, LysR family RBY4I:2.694..2.695 Mbp (870 bp) score=20
luxR autoinducer-binding transcriptional regulator LuxR RBY4I:2.916..2.917 Mbp (756 bp) score=20
RBY4I_669 [K] COG1678 Putative transcriptional regulator RBY4I:2.992..2.992 Mbp (558 bp) score=20
RBY4I_1960 transcriptional regulatory protein RBY4I:3.027..3.027 Mbp (861 bp) score=20
fnrL transcriptional activator protein FnrL [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RBY4I:3.055..3.055 Mbp (741 bp) score=20
RBY4I_3432 transcriptional regulator, LuxR family, putative RBY4I:3.057..3.058 Mbp (729 bp) score=20
RBY4I_1986 transcriptional regulator, HxlR family RBY4I:3.107..3.108 Mbp (408 bp) score=20
RBY4I_2027 [K] COG2378 Predicted transcriptional regulator; helix-turn-helix, type 11 RBY4I:3.221..3.222 Mbp (690 bp) score=20
RBY4I_2504 transcriptional regulator, AraC family RBY4I:3.222..3.223 Mbp (870 bp) score=20
chvI DNA-binding response regulator ChvI [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RBY4I:3.437..3.438 Mbp (705 bp) score=20
pdhR [K] COG1802 Transcriptional regulators RBY4I:3.478..3.479 Mbp (771 bp) score=20
RBY4I_3683 DNA-binding response regulator [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RBY4I:3.625..3.626 Mbp (705 bp) score=20
RBY4I_2088 [K] COG1396 Predicted transcriptional regulators RBY4I:3.644..3.645 Mbp (549 bp) score=20
RBY4I_589 [K] COG2378 Predicted transcriptional regulator; helix-turn-helix, type 11 RBY4I:3.71..3.711 Mbp (714 bp) score=20
RBY4I_3302 transcriptional regulator, AraC family RBY4I:3.765..3.766 Mbp (999 bp) score=20
RBY4I_2919 transcriptional regulator, AraC family RBY4I:3.801..3.802 Mbp (957 bp) score=20
petR DNA-binding response regulator PetR [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RBY4I:3.805..3.805 Mbp (702 bp) score=20
RBY4I_1814 transcriptional regulator, AraC family RBY4I:3.816..3.817 Mbp (942 bp) score=20
parB [K] COG1475 Predicted transcriptional regulators RBY4I:3.884..3.884 Mbp (894 bp) score=20
hrcA [K] COG1420 Transcriptional regulator of heat shock gene RBY4I:3.887..3.889 Mbp (1.065 kbp) score=20
RBY4I_1531 response regulator receiver modulated serine phosphatase [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RBY4I:3.904..3.905 Mbp (1.254 kbp) score=20
RBY4I_3587 transcriptional regulatory protein RBY4I:4.03..4.031 Mbp (588 bp) score=20
RBY4I_3772 putative anti-sigma regulatory factor, serine/threonine protein kinase [T] COG2172 Anti-sigma regulatory factor (Ser/Thr protein kinase) RBY4I:4.034..4.035 Mbp (342 bp) score=20
RBY4I_286 [K] COG1396 Predicted transcriptional regulators RBY4I:4.037..4.038 Mbp (570 bp) score=20
RBY4I_791 transcriptional regulator, AraC family RBY4I:4.042..4.043 Mbp (1.014 kbp) score=20
RBY4I_2542 DNA-binding response regulator [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain RBY4I:4.053..4.053 Mbp (597 bp) score=20
RBY4I_1119 DNA-binding response regulator, LuxR family [TK] COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain RBY4I:4.065..4.066 Mbp (663 bp) score=20
RBY4I_950 transcriptional regulator RBY4I:4.161..4.162 Mbp (342 bp) score=20
RBY4I_4127 transcriptional regulator, GntR family RBY4I:4.181..4.182 Mbp (675 bp) score=20
repBf [K] COG1475 Predicted transcriptional regulators RBY4I:4.197..4.198 Mbp (975 bp) score=20
RBY4I_4213 transcriptional regulator, LuxR family RBY4I:4.244..4.245 Mbp (798 bp) score=20
RBY4I_4094 [K] COG1396 Predicted transcriptional regulators RBY4I:4.247..4.248 Mbp (804 bp) score=20
dctP [K] COG0583 Transcriptional regulator RBY4I:4.26..4.261 Mbp (1.014 kbp) score=20
RBY4I_4157 transcriptional regulator, AraC family RBY4I:4.333..4.334 Mbp (891 bp) score=20
RBY4I_70 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:26.36..26.54 kbp (186 bp) score=10
RBY4I_22 [R] COG0641 Arylsulfatase regulator (Fe-S oxidoreductase) RBY4I:78.18..79.6 kbp (1.425 kbp) score=10
RBY4I_102 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:99.96..100.3 kbp (354 bp) score=10
RBY4I_85 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:109.6..110.1 kbp (504 bp) score=10
RBY4I_101 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:115.2..117.8 kbp (2.55 kbp) score=10
RBY4I_90 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:118.9..120 kbp (1.074 kbp) score=10
RBY4I_136 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:134.6..135.1 kbp (510 bp) score=10
RBY4I_127 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:141.3..142.5 kbp (1.221 kbp) score=10
RBY4I_145 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:205.9..206.4 kbp (513 bp) score=10
cheB [NT] COG2201 Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain RBY4I:216.2..217.2 kbp (993 bp) score=10
RBY4I_191 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:238.4..239.8 kbp (1.431 kbp) score=10
RBY4I_184 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:261.5..261.9 kbp (420 bp) score=10
RBY4I_209 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:263.3..263.7 kbp (382 bp) score=10
RBY4I_1967 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:276.8..277.3 kbp (531 bp) score=10
RBY4I_2913 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:289..290 kbp (1.047 kbp) score=10
RBY4I_652 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:291..291.1 kbp (102 bp) score=10
RBY4I_2950 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:327.4..327.7 kbp (357 bp) score=10
RBY4I_2647 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:331.3..331.7 kbp (399 bp) score=10
RBY4I_3325 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:337.2..337.5 kbp (366 bp) score=10
RBY4I_1696 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:338.5..341.2 kbp (2.7 kbp) score=10
RBY4I_3976 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:358.3..359.6 kbp (1.281 kbp) score=10
RBY4I_841 sensor histidine kinase/response regulator RBY4I:367.6..369.8 kbp (2.202 kbp) score=10
RBY4I_1236 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:375.4..375.8 kbp (459 bp) score=10
RBY4I_3077 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:376.8..378 kbp (1.164 kbp) score=10
nosR regulatory protein NosR RBY4I:380.7..382.8 kbp (2.085 kbp) score=10
pqqD [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:384.7..384.9 kbp (288 bp) score=10
RBY4I_1202 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:390.2..390.7 kbp (501 bp) score=10
RBY4I_1400 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:403.4..404 kbp (678 bp) score=10
RBY4I_1879 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:423.3..423.6 kbp (351 bp) score=10
RBY4I_1742 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:431.2..432.9 kbp (1.743 kbp) score=10
RBY4I_1027 response regulator receiver protein, putative RBY4I:438..438.6 kbp (636 bp) score=10
RBY4I_1661 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:441..441.6 kbp (615 bp) score=10
RBY4I_2492 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:452.5..453 kbp (549 bp) score=10
RBY4I_1054 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:472.7..473.4 kbp (666 bp) score=10
RBY4I_3943 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:476.4..476.9 kbp (480 bp) score=10
RBY4I_827 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:477.1..477.7 kbp (534 bp) score=10
RBY4I_1707 response regulator receiver domain protein RBY4I:497.1..497.5 kbp (474 bp) score=10
RBY4I_2433 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:505..505.5 kbp (507 bp) score=10
RBY4I_2040 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:505.5..505.9 kbp (363 bp) score=10
RBY4I_1988 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:505.9..507 kbp (1.146 kbp) score=10
RBY4I_833 [K] COG3327 Phenylacetic acid-responsive transcriptional repressor RBY4I:515.4..516.2 kbp (801 bp) score=10
RBY4I_507 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:521.6..523.7 kbp (2.085 kbp) score=10
RBY4I_3449 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:525.8..526 kbp (198 bp) score=10
RBY4I_778 [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases RBY4I:526.1..526.7 kbp (588 bp) score=10
RBY4I_2819 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:553.2..554 kbp (756 bp) score=10
RBY4I_740 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:569.1..569.5 kbp (429 bp) score=10
RBY4I_3750 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:580..580.4 kbp (372 bp) score=10
RBY4I_565 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:592.1..592.5 kbp (423 bp) score=10
RBY4I_3434 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:600.7..601 kbp (312 bp) score=10
RBY4I_655 response regulator receiver RBY4I:618.1..618.6 kbp (462 bp) score=10
cse4 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:635.8..636.9 kbp (1.062 kbp) score=10
cas5e [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:636.9..637.6 kbp (699 bp) score=10
cse3 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:637.6..638.3 kbp (672 bp) score=10
RBY4I_823 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:639.3..639.5 kbp (144 bp) score=10
RBY4I_3800 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:647.5..649.1 kbp (1.614 kbp) score=10
RBY4I_828 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:677.7..677.9 kbp (189 bp) score=10
napD_1 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:708.7..709.8 kbp (1.032 kbp) score=10
RBY4I_451 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:709.8..711.8 kbp (1.944 kbp) score=10
RBY4I_421 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:711.9..712.6 kbp (744 bp) score=10
RBY4I_543 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:717.5..718.1 kbp (534 bp) score=10
RBY4I_665 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:737.9..738.5 kbp (573 bp) score=10
RBY4I_557 response regulator receiver sensor signal transduction histidine kinase RBY4I:789.3..790.4 kbp (1.092 kbp) score=10
RBY4I_3000 response regulator receiver RBY4I:790.4..790.9 kbp (495 bp) score=10
RBY4I_1787 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:799.8..801.1 kbp (1.293 kbp) score=10
RBY4I_1846 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:821.4..821.9 kbp (459 bp) score=10
RBY4I_1109 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:834.5..837.1 kbp (2.679 kbp) score=10
gacS response regulator, sensor histidine kinase component GacS RBY4I:844.2..846.6 kbp (2.382 kbp) score=10
RBY4I_3015 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:867..867.8 kbp (801 bp) score=10
RBY4I_2437 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:899.3..902.9 kbp (3.63 kbp) score=10
RBY4I_988 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:920.3..921.1 kbp (816 bp) score=10
RBY4I_1142 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:949.5..950.1 kbp (576 bp) score=10
RBY4I_855 response regulator receiver protein RBY4I:963.6..964.9 kbp (1.239 kbp) score=10
RBY4I_754 [M] COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RBY4I:969.6..970.4 kbp (786 bp) score=10
RBY4I_2272 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:998.9..999.7 kbp (774 bp) score=10
RBY4I_3364 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.039..1.041 Mbp (1.374 kbp) score=10
RBY4I_2541 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.092..1.092 Mbp (477 bp) score=10
RBY4I_1877 response regulator PleD RBY4I:1.094..1.095 Mbp (1.395 kbp) score=10
RBY4I_571 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.095..1.096 Mbp (285 bp) score=10
RBY4I_2360 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit; Heme NO binding, putative RBY4I:1.099..1.099 Mbp (513 bp) score=10
RBY4I_1416 [T] COG3706 Response regulator containing a CheY-like receiver domain and a GGDEF domain RBY4I:1.099..1.1 Mbp (1.053 kbp) score=10
RBY4I_1470 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.129..1.13 Mbp (507 bp) score=10
RBY4I_280 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.166..1.168 Mbp (2.484 kbp) score=10
RBY4I_309 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.186..1.186 Mbp (492 bp) score=10
RBY4I_1957 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.187..1.188 Mbp (990 bp) score=10
RBY4I_1087 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.206..1.207 Mbp (519 bp) score=10
RBY4I_2750 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.208..1.208 Mbp (471 bp) score=10
RBY4I_3405 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.225..1.226 Mbp (438 bp) score=10
RBY4I_576 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.363..1.364 Mbp (1.014 kbp) score=10
RBY4I_3671 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.375..1.376 Mbp (1.194 kbp) score=10
RBY4I_3605 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.378..1.378 Mbp (642 bp) score=10
RBY4I_2227 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.389..1.39 Mbp (1.401 kbp) score=10
RBY4I_1882 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.403..1.404 Mbp (957 bp) score=10
RBY4I_615 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.421..1.422 Mbp (309 bp) score=10
RBY4I_3711 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.434..1.434 Mbp (759 bp) score=10
RBY4I_2157 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.463..1.465 Mbp (1.98 kbp) score=10
ilvN [E] COG0440 Acetolactate synthase, small (regulatory) subunit RBY4I:1.47..1.471 Mbp (561 bp) score=10
RBY4I_3201 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.485..1.486 Mbp (462 bp) score=10
RBY4I_981 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.497..1.498 Mbp (1.431 kbp) score=10
RBY4I_3632 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.505..1.506 Mbp (543 bp) score=10
RBY4I_2263 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.512..1.513 Mbp (1.167 kbp) score=10
RBY4I_2925 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.523..1.523 Mbp (537 bp) score=10
RBY4I_1326 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.541..1.541 Mbp (276 bp) score=10
RBY4I_2002 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.549..1.549 Mbp (300 bp) score=10
RBY4I_2289 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.556..1.559 Mbp (2.193 kbp) score=10
RBY4I_493 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.564..1.564 Mbp (417 bp) score=10
RBY4I_486 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.568..1.568 Mbp (522 bp) score=10
RBY4I_3705 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.582..1.585 Mbp (2.757 kbp) score=10
RBY4I_3990 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.596..1.597 Mbp (702 bp) score=10
RBY4I_2724 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.609..1.612 Mbp (2.922 kbp) score=10
RBY4I_2417 [O] COG0425 Predicted redox protein, regulator of disulfide bond formation RBY4I:1.612..1.612 Mbp (270 bp) score=10
RBY4I_3047 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.613..1.614 Mbp (1.23 kbp) score=10
RBY4I_3148 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.647..1.649 Mbp (1.629 kbp) score=10
RBY4I_1784 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.656..1.658 Mbp (1.485 kbp) score=10
RBY4I_3617 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.663..1.663 Mbp (522 bp) score=10
RBY4I_1840 [M] COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RBY4I:1.663..1.664 Mbp (585 bp) score=10
RBY4I_3677 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.689..1.689 Mbp (288 bp) score=10
ligA [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.69..1.692 Mbp (2.253 kbp) score=10
RBY4I_1683 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.721..1.722 Mbp (1.038 kbp) score=10
RBY4I_1118 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.756..1.758 Mbp (1.674 kbp) score=10
RBY4I_3265 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.772..1.774 Mbp (1.152 kbp) score=10
RBY4I_1195 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.832..1.833 Mbp (678 bp) score=10
phoU phosphate transport system regulatory protein PhoU RBY4I:1.851..1.852 Mbp (711 bp) score=10
RBY4I_2513 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.895..1.896 Mbp (297 bp) score=10
RBY4I_1010 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.898..1.899 Mbp (852 bp) score=10
lexA [KT] COG1974 SOS-response transcriptional repressors (RecA-mediated autopeptidases) RBY4I:1.933..1.934 Mbp (702 bp) score=10
RBY4I_2503 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.948..1.949 Mbp (594 bp) score=10
RBY4I_2616 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:1.977..1.978 Mbp (1.575 kbp) score=10
RBY4I_1418 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.013..2.013 Mbp (321 bp) score=10
RBY4I_2127 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.014..2.015 Mbp (387 bp) score=10
RBY4I_1285 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.022..2.026 Mbp (3.915 kbp) score=10
RBY4I_757 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.028..2.029 Mbp (660 bp) score=10
RBY4I_2126 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.03..2.03 Mbp (408 bp) score=10
RBY4I_3627 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.051..2.051 Mbp (354 bp) score=10
RBY4I_3421 [M] COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RBY4I:2.056..2.056 Mbp (471 bp) score=10
RBY4I_1904 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.057..2.057 Mbp (684 bp) score=10
RBY4I_1480 nitrogen regulatory protein P-II RBY4I:2.064..2.065 Mbp (339 bp) score=10
RBY4I_3138 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.112..2.113 Mbp (1.524 kbp) score=10
RBY4I_1671 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.129..2.131 Mbp (1.194 kbp) score=10
trbL [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.135..2.136 Mbp (1.287 kbp) score=10
RBY4I_2598 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.17..2.172 Mbp (1.092 kbp) score=10
RBY4I_852 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.176..2.177 Mbp (621 bp) score=10
RBY4I_2028 response regulator RBY4I:2.224..2.224 Mbp (381 bp) score=10
RBY4I_3023 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.231..2.232 Mbp (252 bp) score=10
soxA [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.249..2.25 Mbp (852 bp) score=10
soxZ [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.25..2.25 Mbp (330 bp) score=10
soxS regulatory protein SoxS RBY4I:2.253..2.253 Mbp (384 bp) score=10
RBY4I_1162 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.26..2.262 Mbp (1.362 kbp) score=10
RBY4I_2226 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.28..2.28 Mbp (309 bp) score=10
RBY4I_2952 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.297..2.297 Mbp (666 bp) score=10
RBY4I_595 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.302..2.303 Mbp (1.188 kbp) score=10
phaP [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.365..2.366 Mbp (450 bp) score=10
RBY4I_934 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.372..2.373 Mbp (1.005 kbp) score=10
RBY4I_1930 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.376..2.377 Mbp (756 bp) score=10
RBY4I_682 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit; PRC-barrel RBY4I:2.39..2.39 Mbp (363 bp) score=10
RBY4I_3759 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.401..2.402 Mbp (882 bp) score=10
RBY4I_1525 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.414..2.415 Mbp (771 bp) score=10
RBY4I_2156 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.432..2.432 Mbp (345 bp) score=10
RBY4I_3404 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.436..2.437 Mbp (1.209 kbp) score=10
RBY4I_1564 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.443..2.444 Mbp (828 bp) score=10
RBY4I_3343 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.483..2.484 Mbp (1.068 kbp) score=10
RBY4I_3849 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.486..2.487 Mbp (942 bp) score=10
RBY4I_419 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.489..2.49 Mbp (1.122 kbp) score=10
RBY4I_2163 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.519..2.52 Mbp (981 bp) score=10
ftsY [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.526..2.527 Mbp (1.191 kbp) score=10
RBY4I_1278 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.532..2.534 Mbp (1.725 kbp) score=10
RBY4I_1506 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.556..2.556 Mbp (327 bp) score=10
RBY4I_1369 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.556..2.557 Mbp (678 bp) score=10
nthA [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.557..2.558 Mbp (699 bp) score=10
RBY4I_3540 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.562..2.563 Mbp (333 bp) score=10
RBY4I_2788 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.573..2.573 Mbp (546 bp) score=10
RBY4I_1682 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.576..2.577 Mbp (1.017 kbp) score=10
RBY4I_3535 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.581..2.581 Mbp (243 bp) score=10
RBY4I_3529 GcrA cell cycle regulator RBY4I:2.604..2.605 Mbp (600 bp) score=10
RBY4I_1949 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.633..2.634 Mbp (333 bp) score=10
RBY4I_948 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.635..2.636 Mbp (519 bp) score=10
RBY4I_786 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.668..2.669 Mbp (471 bp) score=10
RBY4I_1214 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.677..2.678 Mbp (213 bp) score=10
RBY4I_1037 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.686..2.686 Mbp (852 bp) score=10
RBY4I_3825 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.688..2.689 Mbp (225 bp) score=10
RBY4I_3581 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.702..2.703 Mbp (453 bp) score=10
RBY4I_1380 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.733..2.734 Mbp (1.842 kbp) score=10
RBY4I_1408 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.735..2.736 Mbp (1.191 kbp) score=10
RBY4I_639 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.746..2.747 Mbp (1.074 kbp) score=10
RBY4I_2888 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.759..2.759 Mbp (324 bp) score=10
RBY4I_2005 response regulator receiver protein RBY4I:2.775..2.775 Mbp (393 bp) score=10
RBY4I_3475 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.776..2.777 Mbp (645 bp) score=10
RBY4I_1345 [T] COG2172 Anti-sigma regulatory factor (Ser/Thr protein kinase) RBY4I:2.777..2.778 Mbp (417 bp) score=10
RBY4I_2675 [T] COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) RBY4I:2.778..2.778 Mbp (357 bp) score=10
RBY4I_3790 [T] COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) RBY4I:2.778..2.779 Mbp (894 bp) score=10
RBY4I_2489 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.781..2.782 Mbp (408 bp) score=10
RBY4I_850 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.825..2.826 Mbp (657 bp) score=10
RBY4I_3959 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit; PRC-barrel domain, putative RBY4I:2.828..2.829 Mbp (420 bp) score=10
RBY4I_3075 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.893..2.895 Mbp (1.788 kbp) score=10
RBY4I_3577 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.912..2.913 Mbp (786 bp) score=10
RBY4I_2365 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.932..2.933 Mbp (702 bp) score=10
RBY4I_3809 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.936..2.936 Mbp (315 bp) score=10
RBY4I_2065 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.949..2.949 Mbp (309 bp) score=10
RBY4I_2061 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.953..2.953 Mbp (924 bp) score=10
RBY4I_3062 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:2.954..2.956 Mbp (2.613 kbp) score=10
RBY4I_1231 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.006..3.006 Mbp (477 bp) score=10
RBY4I_2378 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.047..3.049 Mbp (2.502 kbp) score=10
RBY4I_276 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.085..3.086 Mbp (1.044 kbp) score=10
RBY4I_2558 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.098..3.098 Mbp (279 bp) score=10
RBY4I_3315 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.118..3.119 Mbp (873 bp) score=10
RBY4I_3487 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.134..3.135 Mbp (1.197 kbp) score=10
RBY4I_2162 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.166..3.167 Mbp (759 bp) score=10
RBY4I_879 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.169..3.169 Mbp (684 bp) score=10
RBY4I_914 [M] COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) RBY4I:3.215..3.217 Mbp (1.959 kbp) score=10
RBY4I_590 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.231..3.232 Mbp (324 bp) score=10
RBY4I_3055 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.232..3.232 Mbp (441 bp) score=10
RBY4I_3307 nitrogen regulatory protein P-II RBY4I:3.254..3.254 Mbp (339 bp) score=10
RBY4I_447 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.268..3.269 Mbp (1.578 kbp) score=10
RBY4I_241 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.274..3.274 Mbp (645 bp) score=10
RBY4I_1053 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.275..3.276 Mbp (1.362 kbp) score=10
RBY4I_417 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.279..3.28 Mbp (1.122 kbp) score=10
RBY4I_836 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.28..3.281 Mbp (1.083 kbp) score=10
RBY4I_2967 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.314..3.315 Mbp (1.572 kbp) score=10
RBY4I_2136 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.349..3.35 Mbp (366 bp) score=10
RBY4I_446 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.384..3.384 Mbp (513 bp) score=10
RBY4I_605 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.428..3.428 Mbp (204 bp) score=10
RBY4I_3433 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.435..3.435 Mbp (438 bp) score=10
RBY4I_999 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.472..3.473 Mbp (480 bp) score=10
RBY4I_1048 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.479..3.48 Mbp (1.392 kbp) score=10
RBY4I_2670 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.512..3.512 Mbp (219 bp) score=10
RBY4I_2620 [K] COG5631 Predicted transcription regulator, contains HTH domain (MarR family) RBY4I:3.529..3.529 Mbp (441 bp) score=10
RBY4I_1256 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.53..3.531 Mbp (1.662 kbp) score=10
RBY4I_316 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.545..3.547 Mbp (2.673 kbp) score=10
RBY4I_3685 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.556..3.558 Mbp (1.803 kbp) score=10
RBY4I_2393 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.561..3.561 Mbp (249 bp) score=10
RBY4I_2376 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.57..3.572 Mbp (1.803 kbp) score=10
RBY4I_2557 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.582..3.583 Mbp (759 bp) score=10
RBY4I_1209 sensory box histidine kinase/response regulator RBY4I:3.623..3.625 Mbp (1.872 kbp) score=10
sdh [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.629..3.63 Mbp (1.068 kbp) score=10
RBY4I_3731 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.631..3.632 Mbp (324 bp) score=10
RBY4I_1581 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.633..3.634 Mbp (1.377 kbp) score=10
RBY4I_3229 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.642..3.642 Mbp (513 bp) score=10
RBY4I_2908 response regulator, putative RBY4I:3.68..3.68 Mbp (441 bp) score=10
RBY4I_2008 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.686..3.687 Mbp (399 bp) score=10
RBY4I_1387 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.692..3.692 Mbp (321 bp) score=10
RBY4I_2567 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.694..3.694 Mbp (531 bp) score=10
RBY4I_3480 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.71..3.71 Mbp (699 bp) score=10
RBY4I_1170 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.728..3.729 Mbp (1.755 kbp) score=10
RBY4I_2087 [N] COG5442 Flagellar biosynthesis regulator FlaF RBY4I:3.731..3.732 Mbp (372 bp) score=10
RBY4I_3562 [N] COG5443 Flagellar biosynthesis regulator FlbT RBY4I:3.732..3.732 Mbp (360 bp) score=10
RBY4I_834 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.776..3.776 Mbp (225 bp) score=10
RBY4I_1432 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.786..3.786 Mbp (438 bp) score=10
RBY4I_2022 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.848..3.849 Mbp (396 bp) score=10
RBY4I_3067 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.849..3.85 Mbp (708 bp) score=10
RBY4I_3200 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.851..3.852 Mbp (315 bp) score=10
regA photosynthetic apparatus regulatory protein RegA RBY4I:3.853..3.853 Mbp (555 bp) score=10
RBY4I_3822 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.866..3.866 Mbp (348 bp) score=10
RBY4I_3539 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.866..3.867 Mbp (372 bp) score=10
RBY4I_1914 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.946..3.947 Mbp (645 bp) score=10
RBY4I_1999 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.952..3.953 Mbp (1.041 kbp) score=10
RBY4I_3094 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.953..3.954 Mbp (1.011 kbp) score=10
RBY4I_420 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.954..3.956 Mbp (1.701 kbp) score=10
ptsN nitrogen regulatory IIA protein RBY4I:3.957..3.958 Mbp (465 bp) score=10
RBY4I_2024 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.963..3.963 Mbp (246 bp) score=10
RBY4I_933 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.972..3.975 Mbp (2.109 kbp) score=10
RBY4I_3914 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.978..3.979 Mbp (921 bp) score=10
RBY4I_3361 response regulator receiver domain protein RBY4I:3.991..3.991 Mbp (702 bp) score=10
RBY4I_2471 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:3.996..3.997 Mbp (1.134 kbp) score=10
RBY4I_751 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:4.014..4.014 Mbp (486 bp) score=10
RBY4I_2371 [T] COG1366 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) RBY4I:4.035..4.035 Mbp (345 bp) score=10
RBY4I_541 sensory box sensor histidine kinase/response regulator RBY4I:4.083..4.086 Mbp (2.268 kbp) score=10
RBY4I_255 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:4.108..4.108 Mbp (549 bp) score=10
RBY4I_3663 sensor histidine kinase/response regulator RBY4I:4.112..4.114 Mbp (2.295 kbp) score=10
RBY4I_2939 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:4.123..4.125 Mbp (2.043 kbp) score=10
RBY4I_1938 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:4.125..4.128 Mbp (2.799 kbp) score=10
RBY4I_2839 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:4.138..4.139 Mbp (465 bp) score=10
RBY4I_2930 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:4.166..4.167 Mbp (243 bp) score=10
cyaCch [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:4.17..4.171 Mbp (1.164 kbp) score=10
RBY4I_3031 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:4.174..4.176 Mbp (1.671 kbp) score=10
RBY4I_4067 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:4.181..4.181 Mbp (603 bp) score=10
repC [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:4.195..4.196 Mbp (474 bp) score=10
RBY4I_4074 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:4.215..4.215 Mbp (345 bp) score=10
RBY4I_4132 [K] COG5665 CCR4-NOT transcriptional regulation complex, NOT5 subunit RBY4I:4.23..4.23 Mbp (729 bp) score=10

- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks

For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70