Roseobase: Ruegeria pomeroyi DSS-3

Showing 1.599 kbp from CP000031.2, positions 99,756 to 101,354

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: DSS3:3962500..3963192, SPOA0355, dmdA, SPO_tRNA-Gly-5, SPO_Sp16SA, chromosome replication initiator, KAATLSIAAVFGLSLVFAVPSHVLLIQAVVLSGVLIFIWTRPNG.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
Reports & Analysis:
  
Data Source
Scroll/Zoom:     
- Overview
__scale__ overview
- Details
__scale__ detail
Definition lineORIGIN detail
Annotated GenesGENE detail
Operonsoperon detail
Coding RegionsCDS detail
tRNAstRNA detail
rRNAsrRNA detail
Pseudogenespseudogene detail
PseudotRNAspseudotRNA detail
DNA/GC ContentDNA/GC Content detail
Clear highlighting

- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
Upload your own data: [Help]
Upload a file    
Add remote annotations: [Help]
Enter Remote Annotation URL  

For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70