Roseobase: Ruegeria sp. TM1040

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: TM1040:3819290..3822502, TM1040_3663, IPR000445, dmdA, TM1040_R0002, TM1040_R0026, TM1040_R0028, transcriptional regulator, MANSPQAKKRARQNEKRFAINKARRSRIRTFLRKVEEAIASGDKEA.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
 Reports & Analysis:
  
Data Source
The following 301 regions match your request.
Matches on TM1040
overview_TM1040
TM1040_1257 two component transcriptional regulator TIGRFAM: Phosphate regulon transcriptional regulatory protein phoB: (1.6e-151); PFAM: response regulator receiver: (8.3e-39) transcriptional regulatory protein-like: (3.6e-26); KEGG: sil:SPO1953 phosphate regulon transcriptional regulatory protein PhoB, ev=1e-118, 90% identity TM1040:1.355..1.355 Mbp (690 bp) score=90
TM1040_3704 GntR family transcriptional regulator TIGRFAM: Phosphonate C-P lyase system, transcriptional regulator PhnF: (2.2e-76); PFAM: regulatory protein GntR, HTH: (1.1e-18) protein of unknown function UPF0074: (0.0007) UbiC transcription regulator-associated: (9.1e-36) Helix-turn-helix, type 11: (0.0041); KEGG: sil:SPO0467 transcriptional regulator, GntR family, ev=2e-80, 61% identity TM1040:3.964..3.965 Mbp (723 bp) score=80
TM1040_0432 LacI family transcriptional regulator PFAM: periplasmic binding protein/LacI transcriptional regulator: (2.6e-05); SMART: regulatory protein, LacI: (6.1e-14); KEGG: jan:Jann_2901 transcriptional regulator, LacI family, ev=1e-122, 62% identity TM1040:444.4..445.5 kbp (1.032 kbp) score=70
TM1040_0537 MerR family transcriptional regulator TIGRFAM: Cu(I)-responsive transcriptional regulator: (2.3e-57); PFAM: regulatory protein, MerR: (9.4e-12); KEGG: sil:SPO0793 Cu(I)-responsive transcriptional regulator, ev=2e-50, 74% identity TM1040:569.4..569.8 kbp (402 bp) score=70
TM1040_1499 TetR family transcriptional regulator PFAM: regulatory protein, TetR: (1.6e-17) Tetracycline transcriptional regulator YcdC-like-like: (9.4e-60); KEGG: sil:SPO1780 transcriptional regulator, TetR family, ev=2e-74, 67% identity TM1040:1.605..1.606 Mbp (612 bp) score=70
TM1040_3128 LacI family transcriptional regulator PFAM: regulatory protein, LacI: (2.3e-06) periplasmic binding protein/LacI transcriptional regulator: (2.2e-12); KEGG: sil:SPO3684 transcriptional regulator, LacI family, ev=1e-163, 85% identity TM1040:3.303..3.304 Mbp (1.026 kbp) score=70
TM1040_3308 LacI family transcriptional regulator PFAM: periplasmic binding protein/LacI transcriptional regulator: (3.2e-09); SMART: regulatory protein, LacI: (1.3e-18); KEGG: jan:Jann_1945 transcriptional regulator, LacI family, ev=1e-107, 58% identity TM1040:3.518..3.519 Mbp (1.041 kbp) score=70
TM1040_3344 LacI family transcriptional regulator PFAM: regulatory protein, LacI: (2.7e-05) periplasmic binding protein/LacI transcriptional regulator: (3.5e-06); KEGG: jan:Jann_1424 transcriptional regulator, LacI family, ev=1e-138, 71% identity TM1040:3.556..3.557 Mbp (1.005 kbp) score=70
TM1040_3470 MarR family transcriptional regulator TIGRFAM: Homoprotocatechuate degradation transcriptional regulator HpaR: (2.2e-37); PFAM: regulatory protein, MarR: (1.7e-20); KEGG: sil:SPO3689 transcriptional regulator, MarR family, ev=3e-38, 60% identity TM1040:3.696..3.696 Mbp (435 bp) score=70
TM1040_0051 two component transcriptional regulator PFAM: response regulator receiver: (6.9e-38) transcriptional regulatory protein-like: (1.4e-18); KEGG: sil:SPO3426 DNA-binding response regulator, ev=1e-117, 92% identity TM1040:53.96..54.65 kbp (687 bp) score=60
TM1040_0111 two component transcriptional regulator PFAM: response regulator receiver: (9.6e-31) transcriptional regulatory protein-like: (1.3e-16); KEGG: sil:SPO3298 DNA-binding response regulator, ev=1e-113, 88% identity TM1040:116.6..117.3 kbp (720 bp) score=60
TM1040_0368 periplasmic binding protein/LacI transcriptional regulator PFAM: periplasmic binding protein/LacI transcriptional regulator: (4.9e-08); KEGG: jan:Jann_1373 periplasmic binding protein/LacI transcriptional regulator, ev=1e-146, 76% identity TM1040:378..379 kbp (1.017 kbp) score=60
TM1040_1399 two component transcriptional regulator PFAM: response regulator receiver: (3e-37) transcriptional regulatory protein-like: (4e-21); KEGG: sil:SPO1679 DNA-binding response regulator CtrA, ev=1e-120, 90% identity TM1040:1.493..1.494 Mbp (720 bp) score=60
TM1040_2070 LysR family transcriptional regulator PFAM: regulatory protein, MarR: (0.0018) regulatory protein, LysR: (2.5e-21) LysR, substrate-binding: (7.1e-34); KEGG: sil:SPO2010 transcriptional regulator, LysR family, ev=1e-114, 61% identity TM1040:2.174..2.175 Mbp (984 bp) score=60
TM1040_2301 AsnC family transcriptional regulator PFAM: regulatory proteins, AsnC/Lrp: (9.1e-24) regulatory protein, ArsR: (0.0044); KEGG: sil:SPO1368 transcriptional regulator, AsnC family, ev=1e-62, 79% identity TM1040:2.42..2.421 Mbp (459 bp) score=60
TM1040_2441 two component transcriptional regulator PFAM: response regulator receiver: (8.4e-34) transcriptional regulatory protein-like: (2.5e-18); KEGG: sil:SPO0710 DNA-binding response regulator ChvI, ev=1e-121, 96% identity TM1040:2.581..2.582 Mbp (702 bp) score=60
TM1040_2733 two component transcriptional regulator PFAM: response regulator receiver: (1e-22) transcriptional regulatory protein-like: (7.6e-17); KEGG: sil:SPO0187 DNA-binding response regulator, ev=2e-81, 69% identity TM1040:2.876..2.877 Mbp (729 bp) score=60
TM1040_2924 two component transcriptional regulator PFAM: response regulator receiver: (6.4e-37) transcriptional regulatory protein-like: (4e-21); KEGG: sil:SPO0251 DNA-binding response regulator PetR, ev=1e-108, 84% identity TM1040:3.095..3.095 Mbp (705 bp) score=60
TM1040_3001 GntR family transcriptional regulator PFAM: regulatory protein GntR, HTH: (1.4e-07) UbiC transcription regulator-associated: (2.2e-27); KEGG: sil:SPO1369 transcriptional regulator, GntR family, ev=6e-74, 59% identity TM1040:3.169..3.17 Mbp (654 bp) score=60
TM1040_3150 GntR family transcriptional regulator PFAM: regulatory protein GntR, HTH: (1e-18) UbiC transcription regulator-associated: (2.7e-46); KEGG: sil:SPO1842 transcriptional regulator, GntR family, ev=3e-80, 61% identity TM1040:3.332..3.333 Mbp (756 bp) score=60
TM1040_3228 AraC family transcriptional regulator PFAM: helix-turn-helix, AraC type: (3.3e-06) AraC-type transcriptional regulator-like: (3.9e-33); KEGG: gsu:GSU3127 transcriptional regulator, AraC family, ev=4e-50, 43% identity TM1040:3.428..3.429 Mbp (900 bp) score=60
TM1040_3232 two component transcriptional regulator PFAM: response regulator receiver: (4.5e-22) transcriptional regulatory protein-like: (1e-23); KEGG: pae:PA4983 probable two-component response regulator, ev=6e-45, 42% identity TM1040:3.434..3.435 Mbp (735 bp) score=60
TM1040_3311 LacI family transcription regulator PFAM: regulatory protein, LacI: (6.5e-08) periplasmic binding protein/LacI transcriptional regulator: (2.2e-13); KEGG: bbr:BB4926 probable LacI-family transcriptional regulator, ev=4e-46, 32% identity TM1040:3.521..3.522 Mbp (1.089 kbp) score=60
TM1040_3335 two component transcriptional regulator PFAM: response regulator receiver: (3.4e-42) transcriptional regulatory protein-like: (1.6e-18); KEGG: bja:blr7619 two-component response regulator, ev=6e-70, 56% identity TM1040:3.547..3.547 Mbp (693 bp) score=60
TM1040_3343 periplasmic binding protein/LacI transcriptional regulator PFAM: periplasmic binding protein/LacI transcriptional regulator: (0.0044); KEGG: jan:Jann_1425 periplasmic binding protein/LacI transcriptional regulator, ev=1e-139, 76% identity TM1040:3.555..3.556 Mbp (951 bp) score=60
TM1040_3373 two component transcriptional regulator PFAM: response regulator receiver: (4.3e-40) transcriptional regulatory protein-like: (1.6e-16); KEGG: bja:bll1029 two-component response regulator, ev=2e-53, 47% identity TM1040:3.587..3.588 Mbp (717 bp) score=60
TM1040_3679 AsnC family transcriptional regulator PFAM: regulatory proteins, AsnC/Lrp: (4.8e-29) regulatory protein, ArsR: (0.0025) Helix-turn-helix, type 11: (0.00089); KEGG: sil:SPO0569 transcriptional regulator, AsnC family, ev=3e-58, 74% identity TM1040:3.935..3.935 Mbp (459 bp) score=60
TM1040_0005 TetR family transcriptional regulator PFAM: regulatory protein, TetR: (5.9e-13); KEGG: sil:SPO0153 transcriptional regulator, TetR family, ev=2e-57, 58% identity TM1040:4.633..5.22 kbp (588 bp) score=50
TM1040_0156 GntR family transcriptional regulator PFAM: regulatory protein GntR, HTH: (4.6e-18) aminotransferase, class I and II: (2.9e-05); KEGG: sil:SPO3562 transcriptional regulator, ev=0.0, 70% identity TM1040:171.6..173 kbp (1.467 kbp) score=50
TM1040_0157 ArsR family transcriptional regulator PFAM: regulatory protein, ArsR: (9.8e-07); KEGG: sil:SPO3563 transcriptional regulator, ArsR family, ev=7e-26, 60% identity TM1040:173.2..173.5 kbp (324 bp) score=50
TM1040_0178 TetR family transcriptional regulator PFAM: HMG-I and HMG-Y, DNA-binding: (0.062) regulatory protein, TetR: (4.8e-11); KEGG: rpb:RPB_4262 transcriptional regulator, TetR family, ev=5e-24, 35% identity TM1040:198.1..198.7 kbp (612 bp) score=50
TM1040_0205 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (5e-17); KEGG: jan:Jann_2521 transcriptional regulator, LysR family, ev=3e-58, 45% identity TM1040:222.7..223.5 kbp (846 bp) score=50
TM1040_0213 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (6.3e-19) LysR, substrate-binding: (6.5e-28); KEGG: vpa:VPA0175 transcriptional regulator, LysR family, ev=1e-52, 36% identity TM1040:229.2..230.1 kbp (903 bp) score=50
TM1040_0319 TetR family transcriptional regulator PFAM: regulatory protein, TetR: (0.0011); KEGG: rba:RB13253 probable TetR-family transcriptional regulator, ev=3e-27, 34% identity TM1040:324.9..325.4 kbp (585 bp) score=50
TM1040_0322 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (3.9e-16) LysR, substrate-binding: (7.6e-29); KEGG: sme:SMa2287 LysR-family transcriptional regulator, ev=5e-46, 41% identity TM1040:326.9..327.7 kbp (873 bp) score=50
TM1040_0354 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (1e-18) LysR, substrate-binding: (2.1e-37); KEGG: jan:Jann_1407 transcriptional regulator, LysR family, ev=1e-113, 66% identity TM1040:359.5..360.5 kbp (933 bp) score=50
TM1040_0362 IclR family transcriptional regulator SMART: regulatory proteins, IclR: (6.6e-20); KEGG: mag:amb2598 transcriptional regulator, ev=5e-35, 36% identity TM1040:371.8..372.6 kbp (798 bp) score=50
TM1040_0365 GntR family transcriptional regulator PFAM: regulatory protein GntR, HTH: (3.2e-07) GntR-like: (2.2e-23); KEGG: psb:Psyr_2675 regulatory protein, GntR:bacterial regulatory protein, GntR, ev=9e-26, 36% identity TM1040:374.9..375.6 kbp (693 bp) score=50
TM1040_0435 TetR family transcriptional regulator PFAM: regulatory protein, TetR: (6.3e-11); KEGG: mlo:mll3671 transcriptional regulator, ev=5e-33, 37% identity TM1040:451.3..451.9 kbp (654 bp) score=50
TM1040_0441 TetR family transcriptional regulator PFAM: regulatory protein, TetR: (1.7e-18); KEGG: sil:SPO0743 transcriptional regulator, TetR family, ev=3e-69, 61% identity TM1040:457.9..458.5 kbp (597 bp) score=50
TM1040_0468 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (1.6e-15) LysR, substrate-binding: (1.2e-17); KEGG: bpa:BPP1605 probable LysR-family transcriptional regulator, ev=4e-36, 38% identity TM1040:486.7..487.6 kbp (846 bp) score=50
TM1040_0509 GntR family transcriptional regulator PFAM: regulatory protein GntR, HTH: (6.2e-11) GntR-like: (6.2e-05); KEGG: sil:SPO3621 transcriptional regulator, GntR family, ev=4e-99, 90% identity TM1040:535.5..536.2 kbp (663 bp) score=50
TM1040_0513 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (6.6e-19) LysR, substrate-binding: (2.6e-37); KEGG: bbr:BB0654 LysR-family transcriptional regulator, ev=1e-37, 34% identity TM1040:539.2..540.1 kbp (909 bp) score=50
TM1040_0526 ArsR family transcriptional regulator PFAM: low molecular weight phosphotyrosine protein phosphatase: (2.4e-35) regulatory protein, ArsR: (0.00029); KEGG: sil:SPO3877 transcriptional regulator/arsenate reductase, ev=1e-124, 77% identity TM1040:552.3..553.2 kbp (831 bp) score=50
TM1040_0545 DeoR family transcriptional regulator PFAM: regulatory protein, DeoR: (5.8e-26) Helix-turn-helix, type 11: (6.4e-07); KEGG: vch:VCA0940 transcriptional regulator, DeoR family, ev=1e-34, 36% identity TM1040:578.6..579.4 kbp (798 bp) score=50
TM1040_0550 MarR family transcriptional regulator PFAM: regulatory protein, MarR: (1.3e-15); KEGG: pha:PSHAa2967 transcriptional regulator, ev=6e-29, 39% identity TM1040:587.7..588.2 kbp (504 bp) score=50
TM1040_0581 AsnC family transcriptional regulator PFAM: regulatory proteins, AsnC/Lrp: (1e-25); KEGG: sil:SPO1425 transcriptional regulator, AsnC family, ev=5e-56, 70% identity TM1040:619.4..619.8 kbp (456 bp) score=50
TM1040_0629 MarR family transcriptional regulator PFAM: regulatory protein, MarR: (6.5e-10); KEGG: sil:SPO0919 transcriptional regulator, MarR family, ev=2e-27, 46% identity TM1040:667.1..667.6 kbp (483 bp) score=50
TM1040_0639 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (1.4e-14) LysR, substrate-binding: (2.1e-05); KEGG: sil:SPO0588 transcriptional regulator, LysR family, ev=7e-32, 31% identity TM1040:681.9..682.9 kbp (954 bp) score=50
TM1040_0676 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (1.6e-17) LysR, substrate-binding: (1.4e-05); KEGG: sil:SPO0980 transcriptional regulator, LysR family, ev=1e-130, 72% identity TM1040:722.5..723.5 kbp (966 bp) score=50
TM1040_0828 two component LuxR family transcriptional regulator PFAM: regulatory protein, LuxR: (3.4e-17) response regulator receiver: (1e-22); KEGG: sil:SPO0161 DNA-binding response regulator, LuxR family, ev=1e-50, 51% identity TM1040:869.4..870 kbp (615 bp) score=50
TM1040_0831 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (2.7e-20) LysR, substrate-binding: (2.2e-21); KEGG: xcv:XCV2178 transcriptional regulator, LysR family, ev=1e-102, 66% identity TM1040:872.9..873.8 kbp (912 bp) score=50
TM1040_0844 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (9.2e-18) LysR, substrate-binding: (3.4e-25); KEGG: sil:SPO1640 transcriptional regulator, LysR family, ev=1e-50, 39% identity TM1040:894.9..895.8 kbp (888 bp) score=50
TM1040_0848 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (1.7e-17) LysR, substrate-binding: (7.2e-38); KEGG: sil:SPO0241 transcriptional regulator, LysR family, ev=1e-110, 64% identity TM1040:900.4..901.3 kbp (909 bp) score=50
TM1040_0876 two component LuxR family transcriptional regulator PFAM: regulatory protein, LuxR: (4.1e-23) response regulator receiver: (1.5e-38) Sigma-70, region 4 type 2: (0.00038); KEGG: sil:SPO2575 DNA-binding response regulator, LuxR family, ev=7e-92, 81% identity TM1040:934.3..935 kbp (702 bp) score=50
TM1040_0910 AsnC family transcriptional regulator PFAM: regulatory proteins, AsnC/Lrp: (6.5e-18); KEGG: mlo:mlr7283 transcriptional regulator, ev=6e-46, 55% identity TM1040:971.1..971.6 kbp (540 bp) score=50
TM1040_0960 two component LuxR family transcriptional regulator PFAM: regulatory protein, LuxR: (6e-19) response regulator receiver: (1.4e-23); KEGG: sil:SPO0161 DNA-binding response regulator, LuxR family, ev=4e-67, 63% identity TM1040:1.026..1.027 Mbp (645 bp) score=50
TM1040_0982 TetR family transcriptional regulator PFAM: regulatory protein, TetR: (7.3e-17); KEGG: sma:SAV4715 TetR-family transcriptional regulator, ev=9e-17, 35% identity TM1040:1.05..1.051 Mbp (585 bp) score=50
TM1040_1107 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (1.3e-14) LysR, substrate-binding: (2.4e-28); KEGG: sil:SPO2202 transcriptional regulator, LysR family, ev=1e-122, 74% identity TM1040:1.19..1.191 Mbp (897 bp) score=50
TM1040_1119 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (1e-22) LysR, substrate-binding: (4.1e-33); KEGG: sil:SPO1872 transcriptional regulator, LysR family, ev=1e-136, 80% identity TM1040:1.202..1.203 Mbp (906 bp) score=50
TM1040_1166 AsnC family transcriptional regulator PFAM: regulatory proteins, AsnC/Lrp: (1.7e-10) Helix-turn-helix, type 11: (0.0027); KEGG: sil:SPO2118 transcriptional regulator, AsnC family, ev=4e-60, 85% identity TM1040:1.255..1.256 Mbp (432 bp) score=50
TM1040_1174 AsnC family transcriptional regulator PFAM: regulatory proteins, AsnC/Lrp: (4.9e-17); KEGG: sme:SMb20425 transcriptional regulator protein, ev=7e-36, 47% identity TM1040:1.264..1.264 Mbp (534 bp) score=50
TM1040_1212 LuxR family transcriptional regulator PFAM: regulatory protein, LuxR: (8.9e-09) Autoinducer-binding: (5.8e-07) Bacterio-opsin activator, HTH: (0.0031) Sigma-70, region 4 type 2: (6.3e-07); KEGG: sil:SPO1974 autoinducer-binding transcriptional regulator, LuxR family, ev=1e-91, 65% identity TM1040:1.301..1.302 Mbp (756 bp) score=50
TM1040_1256 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (5.5e-17) LysR, substrate-binding: (1.7e-38); KEGG: sil:SPO1954 transcriptional regulator, LysR family, ev=1e-111, 65% identity TM1040:1.354..1.354 Mbp (933 bp) score=50
TM1040_1382 TetR family transcriptional regulator PFAM: regulatory protein, TetR: (5e-13); KEGG: sil:SPO3896 transcriptional regulator, TetR family, ev=3e-89, 79% identity TM1040:1.476..1.477 Mbp (618 bp) score=50
TM1040_1386 GntR family transcriptional regulator PFAM: regulatory protein GntR, HTH: (4.7e-18) aminotransferase, class I and II: (5.3e-07); KEGG: sil:SPO1690 transcriptional regulator, GntR family, ev=0.0, 67% identity TM1040:1.48..1.482 Mbp (1.416 kbp) score=50
TM1040_1461 two component, sigma54 specific, Fis family transcriptional regulator PFAM: response regulator receiver: (5.5e-44) sigma-54 factor, interaction region: (1.6e-28) helix-turn-helix, Fis-type: (9.6e-07) ATPase associated with various cellular activities, AAA_5: (0.00016); SMART: ATPase: (9.8e-10); KEGG: sil:SPO1892 C4-dicarboxylate transport transcriptional regulatory protein DctD, ev=0.0, 92% identity TM1040:1.561..1.563 Mbp (1.338 kbp) score=50
TM1040_1478 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (2.6e-16) LysR, substrate-binding: (4.7e-32); KEGG: sil:SPO2171 transcriptional regulator, LysR family, ev=1e-115, 67% identity TM1040:1.579..1.579 Mbp (930 bp) score=50
TM1040_1516 LuxR family transcriptional regulator PFAM: regulatory protein, LuxR: (1.7e-17); KEGG: sil:SPO1012 transcriptional regulator, LuxR family, ev=2e-59, 63% identity TM1040:1.623..1.623 Mbp (549 bp) score=50
TM1040_1546 MarR family transcriptional regulator PFAM: regulatory protein, MarR: (1.6e-14); KEGG: bja:bll4221 transcriptional regulatory protein, ev=5e-27, 48% identity TM1040:1.654..1.654 Mbp (486 bp) score=50
TM1040_1554 MerR family transcriptional regulator PFAM: regulatory protein, MerR: (3e-05); KEGG: sil:SPO2912 transcriptional regulator, MerR family, ev=3e-46, 75% identity TM1040:1.661..1.661 Mbp (369 bp) score=50
TM1040_1556 MerR family transcriptional regulator PFAM: regulatory protein, MerR: (2.3e-10); KEGG: sil:SPO2914 transcriptional regulator, MerR family, ev=1e-57, 81% identity TM1040:1.661..1.662 Mbp (402 bp) score=50
TM1040_1583 TetR family transcriptional regulator PFAM: regulatory protein, TetR: (0.0022); KEGG: jan:Jann_2994 transcriptional regulator, TetR family, ev=4e-54, 55% identity TM1040:1.692..1.693 Mbp (597 bp) score=50
TM1040_1596 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (5.4e-21) LysR, substrate-binding: (1.4e-36); KEGG: sil:SPO2879 transcriptional regulator, LysR family, ev=5e-97, 60% identity TM1040:1.707..1.708 Mbp (966 bp) score=50
TM1040_1699 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (1.1e-18) LysR, substrate-binding: (5.8e-36); KEGG: sil:SPO3015 transcriptional regulator MetR, ev=1e-143, 84% identity TM1040:1.795..1.796 Mbp (906 bp) score=50
TM1040_1731 MarR family transcriptional regulator PFAM: regulatory protein, MarR: (1.1e-09); KEGG: jan:Jann_2651 transcriptional regulator, MarR family, ev=6e-70, 76% identity TM1040:1.827..1.828 Mbp (498 bp) score=50
TM1040_1748 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (1.3e-20) LysR, substrate-binding: (1.5e-35); KEGG: sil:SPO3490 transcriptional regulator, LysR family, ev=1e-103, 63% identity TM1040:1.841..1.842 Mbp (912 bp) score=50
TM1040_1751 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (1.4e-21) LysR, substrate-binding: (1.3e-14); KEGG: bur:Bcep18194_B2495 transcriptional regulator, LysR family, ev=9e-39, 34% identity TM1040:1.844..1.845 Mbp (900 bp) score=50
TM1040_1755 AsnC family transcriptional regulator PFAM: regulatory proteins, AsnC/Lrp: (1.5e-21); KEGG: sil:SPO2631 transcriptional regulator, AsnC family, ev=9e-71, 88% identity TM1040:1.847..1.847 Mbp (480 bp) score=50
TM1040_1814 two component, sigma54 specific, Fis family transcriptional regulator PFAM: response regulator receiver: (1.8e-31) sigma-54 factor, interaction region: (6.1e-23) helix-turn-helix, Fis-type: (1.1e-08); KEGG: sil:SPO2629 C4-dicarboxylate transport transcriptional regulatory protein, ev=1e-161, 71% identity TM1040:1.906..1.908 Mbp (1.23 kbp) score=50
TM1040_1885 TetR family transcriptional regulator PFAM: regulatory protein, TetR: (1e-13); KEGG: sil:SPO1086 transcriptional regulator, TetR family, ev=4e-54, 54% identity TM1040:1.986..1.986 Mbp (591 bp) score=50
TM1040_1911 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (6.6e-20) LysR, substrate-binding: (8e-10); KEGG: sil:SPO2961 transcriptional regulator, LysR family, ev=4e-96, 60% identity TM1040:2.014..2.014 Mbp (918 bp) score=50
TM1040_1951 Crp/FNR family transcriptional regulator PFAM: cyclic nucleotide-binding: (1.9e-24) regulatory protein, Crp: (4e-07); KEGG: sil:SPO1335 transcriptional regulator, Crp/Fnr family, ev=2e-70, 61% identity TM1040:2.054..2.055 Mbp (669 bp) score=50
TM1040_1963 TetR family transcriptional regulator PFAM: regulatory protein, TetR: (2.4e-13); KEGG: sil:SPO3545 transcriptional regulator, TetR family, ev=2e-29, 40% identity TM1040:2.067..2.068 Mbp (573 bp) score=50
TM1040_2004 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (3.5e-19) LysR, substrate-binding: (1.3e-20); KEGG: sil:SPOA0284 transcriptional regulator, LysR family, ev=6e-64, 48% identity TM1040:2.11..2.11 Mbp (882 bp) score=50
TM1040_2005 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (4.3e-21) LysR, substrate-binding: (5.4e-21); KEGG: bur:Bcep18194_C7696 transcriptional regulator, LysR family, ev=1e-39, 34% identity TM1040:2.11..2.111 Mbp (891 bp) score=50
TM1040_2061 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (1.7e-19) LysR, substrate-binding: (1.6e-46); KEGG: sil:SPO2238 transcriptional regulator, LysR family, ev=3e-85, 56% identity TM1040:2.164..2.165 Mbp (921 bp) score=50
TM1040_2081 MerR family transcriptional regulator PFAM: regulatory protein, MerR: (5.7e-11); KEGG: pfo:Pfl_0677 possible transcriptional regulator, MerR family, ev=8e-19, 43% identity TM1040:2.187..2.187 Mbp (354 bp) score=50
TM1040_2104 AsnC family transcriptional regulator PFAM: regulatory proteins, AsnC/Lrp: (1.3e-24); KEGG: sil:SPO3179 transcriptional regulator, AsnC family, ev=3e-64, 80% identity TM1040:2.21..2.21 Mbp (462 bp) score=50
TM1040_2112 IclR family transcriptional regulator SMART: regulatory proteins, IclR: (7.6e-09); KEGG: pfo:Pfl_1294 transcriptional regulator, IclR family, ev=1e-19, 27% identity TM1040:2.217..2.218 Mbp (807 bp) score=50
TM1040_2148 TetR family transcriptional regulator PFAM: regulatory protein, TetR: (4.9e-12); KEGG: bat:BAS2304 transcriptional regulator, TetR family, ev=1e-10, 29% identity TM1040:2.256..2.256 Mbp (687 bp) score=50
TM1040_2162 TetR family transcriptional regulator PFAM: regulatory protein, TetR: (7.5e-12); KEGG: sil:SPO1736 transcriptional regulator, TetR family, ev=1e-70, 72% identity TM1040:2.272..2.273 Mbp (630 bp) score=50
TM1040_2167 GntR family transcriptional regulator PFAM: regulatory protein GntR, HTH: (9.8e-13) aminotransferase, class I and II: (5e-08); KEGG: sil:SPO3185 transcriptional regulator, GntR family, ev=1e-139, 55% identity TM1040:2.278..2.279 Mbp (1.398 kbp) score=50
TM1040_2192 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (3e-16) LysR, substrate-binding: (1e-25); KEGG: mlo:mlr1832 probable transcriptional regulator, ev=7e-75, 51% identity TM1040:2.303..2.303 Mbp (879 bp) score=50
TM1040_2241 MarR family transcriptional regulator PFAM: regulatory protein, MarR: (1.2e-10); KEGG: jan:Jann_1325 transcriptional regulator, MarR family, ev=1e-40, 60% identity TM1040:2.355..2.355 Mbp (486 bp) score=50
TM1040_2247 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (5.7e-19) LysR, substrate-binding: (2.9e-40); KEGG: cvi:CV1773 GstR-like transcriptional regulator protein, ev=1e-81, 51% identity TM1040:2.361..2.362 Mbp (933 bp) score=50
TM1040_2296 GntR family transcriptional regulator PFAM: regulatory protein GntR, HTH: (4e-17) GntR-like: (5.5e-30); KEGG: sil:SPO1375 transcriptional regulator, GntR family, ev=7e-88, 81% identity TM1040:2.416..2.416 Mbp (651 bp) score=50
TM1040_2302 AsnC family transcriptional regulator PFAM: regulatory proteins, AsnC/Lrp: (7.6e-14); KEGG: sil:SPO1367 transcriptional regulator, AsnC family, ev=6e-52, 67% identity TM1040:2.421..2.421 Mbp (456 bp) score=50
TM1040_2454 MarR family transcriptional regulator PFAM: regulatory protein, MarR: (5.6e-17); KEGG: sil:SPO3583 transcriptional regulator PecS, ev=1e-49, 62% identity TM1040:2.597..2.597 Mbp (489 bp) score=50
TM1040_2460 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (2.6e-18) LysR, substrate-binding: (2.9e-51); KEGG: sil:SPO3592 transcriptional regulator, LysR family, ev=1e-154, 90% identity TM1040:2.603..2.604 Mbp (906 bp) score=50
TM1040_2497 TetR family transcriptional regulator PFAM: regulatory protein, TetR: (1.5e-15); KEGG: mtc:MT1047 transcriptional regulator, TetR family, ev=7e-10, 43% identity TM1040:2.639..2.64 Mbp (606 bp) score=50
TM1040_2541 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (2.6e-17) LysR, substrate-binding: (5.5e-31); KEGG: jan:Jann_4071 transcriptional regulator, LysR family, ev=3e-52, 43% identity TM1040:2.682..2.683 Mbp (885 bp) score=50
TM1040_2597 ArsR family transcriptional regulator PFAM: regulatory protein, ArsR: (1.8e-11); KEGG: sil:SPO3238 transcriptional regulator, ArsR family, ev=5e-46, 87% identity TM1040:2.735..2.736 Mbp (330 bp) score=50
TM1040_2599 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (5.8e-14) LysR, substrate-binding: (6.3e-32); KEGG: sil:SPO3240 transcriptional regulator, LysR family, ev=1e-123, 73% identity TM1040:2.737..2.737 Mbp (879 bp) score=50
TM1040_2614 MerR family transcriptional regulator PFAM: regulatory protein, MerR: (1.8e-10); KEGG: sil:SPO3734 transcriptional regulator, MerR family, ev=3e-39, 56% identity TM1040:2.748..2.748 Mbp (426 bp) score=50
TM1040_2620 MarR family transcriptional regulator PFAM: regulatory protein, MarR: (1.5e-10); KEGG: sil:SPO0687 transcriptional regulator, MarR family, ev=1e-45, 64% identity TM1040:2.753..2.753 Mbp (459 bp) score=50
TM1040_2657 AsnC family transcriptional regulator PFAM: regulatory proteins, AsnC/Lrp: (6.9e-19); KEGG: sil:SPO0233 transcriptional regulator, AsnC family, ev=2e-60, 81% identity TM1040:2.793..2.793 Mbp (429 bp) score=50
TM1040_2688 GntR family transcriptional regulator PFAM: regulatory protein GntR, HTH: (3.8e-15) GntR-like: (8.8e-20); KEGG: sil:SPO2550 transcriptional regulator, GntR family, ev=4e-80, 61% identity TM1040:2.828..2.828 Mbp (840 bp) score=50
TM1040_2693 AsnC family transcriptional regulator PFAM: regulatory proteins, AsnC/Lrp: (8.7e-19); KEGG: sil:SPO1138 transcriptional regulator, AsnC family, ev=1e-73, 85% identity TM1040:2.835..2.836 Mbp (480 bp) score=50
TM1040_2698 IclR family transcriptional regulator PFAM: regulatory proteins, IclR: (6.2e-41); KEGG: jan:Jann_3261 transcriptional regulator, IclR family, ev=1e-102, 68% identity TM1040:2.84..2.841 Mbp (843 bp) score=50
TM1040_2703 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (1.2e-20) LysR, substrate-binding: (9e-45); KEGG: sme:SMb21291 transcriptional regulator, LysR family protein, ev=1e-104, 59% identity TM1040:2.845..2.846 Mbp (912 bp) score=50
TM1040_2708 AsnC family transcriptional regulator PFAM: regulatory proteins, AsnC/Lrp: (4.2e-24); KEGG: atc:AGR_L_238 hypothetical transcriptional regulator Y4TD, ev=6e-39, 49% identity TM1040:2.853..2.853 Mbp (468 bp) score=50
TM1040_2738 AsnC family transcriptional regulator PFAM: regulatory proteins, AsnC/Lrp: (1.9e-30); KEGG: sil:SPOA0317 transcriptional regulator, AsnC family, ev=3e-66, 81% identity TM1040:2.883..2.884 Mbp (459 bp) score=50
TM1040_2780 AsnC family transcriptional regulator PFAM: regulatory proteins, AsnC/Lrp: (1.8e-20); KEGG: sil:SPO0389 transcriptional regulator, AsnC family, ev=2e-33, 46% identity TM1040:2.939..2.94 Mbp (468 bp) score=50
TM1040_2792 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (2.6e-20) LysR, substrate-binding: (4.9e-45); KEGG: bja:bll0777 transcriptional regulatory protein, ev=1e-111, 70% identity TM1040:2.954..2.954 Mbp (924 bp) score=50
TM1040_2905 MarR family transcriptional regulator PFAM: regulatory protein, MarR: (3.4e-08); KEGG: sil:SPO0068 transcriptional regulator, , ev=2e-54, 72% identity TM1040:3.073..3.073 Mbp (441 bp) score=50
TM1040_2925 MarR family transcriptional regulator PFAM: regulatory protein, MarR: (1.2e-07); KEGG: sil:SPO0252 transcriptional regulator PetP, ev=5e-71, 79% identity TM1040:3.095..3.096 Mbp (513 bp) score=50
TM1040_2928 MarR family transcriptional regulator PFAM: regulatory protein, MarR: (8.1e-20); KEGG: sil:SPO0255 transcriptional regulator, MarR family, ev=3e-44, 61% identity TM1040:3.098..3.098 Mbp (432 bp) score=50
TM1040_2931 MerR family transcriptional regulator PFAM: regulatory protein, MerR: (3e-11); KEGG: sil:SPOA0389 transcriptional regulator, MerR family, ev=5e-39, 56% identity TM1040:3.1..3.1 Mbp (417 bp) score=50
TM1040_2985 GntR family transcriptional regulator PFAM: regulatory protein GntR, HTH: (3.1e-13) GntR-like: (1.2e-09); KEGG: sil:SPO3470 transcriptional regulator, GntR family, ev=9e-71, 65% identity TM1040:3.15..3.15 Mbp (747 bp) score=50
TM1040_3010 GntR family transcriptional regulator PFAM: regulatory protein GntR, HTH: (1.2e-14) GntR-like: (1.5e-05); KEGG: sil:SPO3340 transcriptional regulator, GntR family, ev=6e-65, 61% identity TM1040:3.179..3.179 Mbp (630 bp) score=50
TM1040_3037 GntR family transcriptional regulator PFAM: regulatory protein GntR, HTH: (1.2e-13); KEGG: jan:Jann_4140 transcriptional regulator, GntR family, ev=2e-27, 37% identity TM1040:3.205..3.206 Mbp (666 bp) score=50
TM1040_3102 LuxR family transcriptional regulator PFAM: regulatory protein, LuxR: (1.5e-08) Autoinducer-binding: (2.6e-19); KEGG: sil:SPO0371 autoinducer-binding transcriptional regulator LuxR, ev=1e-71, 51% identity TM1040:3.273..3.274 Mbp (720 bp) score=50
TM1040_3138 TetR family transcriptional regulator PFAM: regulatory protein, TetR: (0.00091); KEGG: sil:SPO0168 transcriptional regulator, TetR family, ev=4e-63, 59% identity TM1040:3.318..3.319 Mbp (624 bp) score=50
TM1040_3158 TetR family transcriptional regulator PFAM: regulatory protein, TetR: (2.4e-07); KEGG: sil:SPO1082 HTH-type transcriptional regulator BetI, ev=1e-44, 49% identity TM1040:3.34..3.341 Mbp (609 bp) score=50
TM1040_3163 AsnC family transcriptional regulator PFAM: regulatory proteins, AsnC/Lrp: (1.7e-22); KEGG: sil:SPO3612 transcriptional regulator, AsnC family, ev=6e-63, 79% identity TM1040:3.345..3.345 Mbp (453 bp) score=50
TM1040_3181 LuxR family transcriptional regulator PFAM: regulatory protein, LuxR: (2.4e-05); KEGG: sil:SPO2286 autoinducer-binding transcriptional regulator LuxR, ev=5e-07, 23% identity TM1040:3.367..3.368 Mbp (804 bp) score=50
TM1040_3185 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (1.7e-22) LysR, substrate-binding: (1.4e-43); KEGG: pfl:PFL_3389 transcriptional regulator, LysR family, ev=7e-78, 51% identity TM1040:3.371..3.372 Mbp (888 bp) score=50
TM1040_3186 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (2.3e-23); KEGG: sil:SPO0639 transcriptional regulator, LysR family, ev=2e-59, 45% identity TM1040:3.372..3.373 Mbp (876 bp) score=50
TM1040_3188 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (2.8e-13) LysR, substrate-binding: (1.7e-27); KEGG: sil:SPO3301 transcriptional regulator, LysR family, ev=5e-78, 51% identity TM1040:3.381..3.381 Mbp (876 bp) score=50
TM1040_3212 TetR family transcriptional regulator PFAM: regulatory protein, TetR: (1.7e-10); KEGG: sil:SPOA0067 transcriptional regulator, TetR family, ev=4e-44, 42% identity TM1040:3.408..3.409 Mbp (642 bp) score=50
TM1040_3227 LuxR family transcriptional regulator PFAM: alpha/beta hydrolase fold: (0.00011) regulatory protein, LuxR: (4.5e-05); KEGG: sil:SPO1388 transcriptional regulator, LuxR family/hydrolase, alpha/beta fold family, ev=3e-31, 26% identity TM1040:3.426..3.428 Mbp (1.638 kbp) score=50
TM1040_3260 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (4.3e-20) LysR, substrate-binding: (2.6e-48); KEGG: transcriptional regulator, LysR family, ev=4e-94, 59% identity TM1040:3.462..3.463 Mbp (918 bp) score=50
TM1040_3273 LuxR family transcriptional regulator PFAM: regulatory protein, LuxR: (2.1e-21); SMART: PAS: (4.3e-06); KEGG: sil:SPO1012 transcriptional regulator, LuxR family, ev=1e-50, 54% identity TM1040:3.477..3.477 Mbp (558 bp) score=50
TM1040_3283 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (1.2e-18) LysR, substrate-binding: (3.4e-27); KEGG: hch:HCH_06627 transcriptional regulator, ev=1e-38, 32% identity TM1040:3.485..3.486 Mbp (891 bp) score=50
TM1040_3324 GntR family transcriptional regulator PFAM: regulatory protein GntR, HTH: (7.4e-21) GntR-like: (1.1e-10); KEGG: sil:SPOA0261 transcriptional regulator, GntR family, ev=2e-82, 68% identity TM1040:3.534..3.535 Mbp (690 bp) score=50
TM1040_3338 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (1.2e-16) LysR, substrate-binding: (1.4e-47); KEGG: bur:Bcep18194_B2913 transcriptional regulator, LysR family, ev=2e-97, 62% identity TM1040:3.55..3.551 Mbp (900 bp) score=50
TM1040_3339 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (1.8e-20) LysR, substrate-binding: (5.2e-43); KEGG: pfl:PFL_2646 transcriptional regulator, LysR family, ev=2e-87, 56% identity TM1040:3.551..3.552 Mbp (897 bp) score=50
TM1040_3363 GntR family transcriptional regulator PFAM: regulatory protein GntR, HTH: (6.1e-19) UbiC transcription regulator-associated: (3.3e-15); KEGG: atc:AGR_L_3074 transcription regulator, GntR family, ev=2e-64, 55% identity TM1040:3.575..3.576 Mbp (750 bp) score=50
TM1040_3380 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (2.6e-17) LysR, substrate-binding: (6e-45); KEGG: sil:SPO3192 transcriptional regulator, LysR family, ev=2e-47, 41% identity TM1040:3.596..3.597 Mbp (906 bp) score=50
TM1040_3388 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (8e-21) LysR, substrate-binding: (7.8e-29); KEGG: bpm:BURPS1710b_0203 transcriptional regulator, LysR family, ev=6e-70, 48% identity TM1040:3.608..3.609 Mbp (918 bp) score=50
TM1040_3400 IclR family transcriptional regulator PFAM: regulatory proteins, IclR: (9.9e-05); KEGG: bur:Bcep18194_B0136 transcriptional regulator, IclR family, ev=4e-58, 45% identity TM1040:3.621..3.622 Mbp (807 bp) score=50
TM1040_3451 TetR family transcriptional regulator PFAM: regulatory protein, TetR: (7.5e-18); KEGG: rsp:RSP_6137 transcriptional regulator, TetR family, ev=2e-58, 58% identity TM1040:3.676..3.677 Mbp (651 bp) score=50
TM1040_3452 ArsR family transcriptional regulator PFAM: regulatory protein, ArsR: (0.0022); KEGG: sil:SPO3809 transcriptional regulator, ArsR family, ev=3e-67, 58% identity TM1040:3.677..3.678 Mbp (705 bp) score=50
TM1040_3477 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (4.6e-19) LysR, substrate-binding: (2.4e-43); KEGG: sil:SPO0870 transcriptional regulator, LysR family, ev=1e-114, 67% identity TM1040:3.702..3.703 Mbp (915 bp) score=50
TM1040_3482 IclR family transcriptional regulator PFAM: regulatory proteins, IclR: (1.8e-32); KEGG: jan:Jann_3839 transcriptional regulator, IclR family, ev=8e-86, 64% identity TM1040:3.714..3.715 Mbp (792 bp) score=50
TM1040_3604 IclR family transcriptional regulator PFAM: regulatory proteins, IclR: (9.3e-16); KEGG: rru:Rru_A1344 transcriptional regulator, IclR family, ev=3e-56, 45% identity TM1040:3.855..3.855 Mbp (762 bp) score=50
TM1040_3629 AsnC family transcriptional regulator PFAM: regulatory proteins, AsnC/Lrp: (3.5e-31); KEGG: sil:SPO0223 transcriptional regulator, AsnC family, ev=1e-68, 85% identity TM1040:3.888..3.889 Mbp (462 bp) score=50
TM1040_3634 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (1.2e-18) LysR, substrate-binding: (6.8e-33); KEGG: sil:SPO0241 transcriptional regulator, LysR family, ev=1e-76, 47% identity TM1040:3.892..3.893 Mbp (915 bp) score=50
TM1040_3674 ArsR family transcriptional regulator PFAM: regulatory protein, ArsR: (4.1e-10); KEGG: sil:SPOA0427 transcriptional regulator, ArsR family, ev=5e-23, 61% identity TM1040:3.929..3.929 Mbp (282 bp) score=50
TM1040_3681 TetR family transcriptional regulator PFAM: regulatory protein, TetR: (1.1e-09); KEGG: sil:SPO0566 transcriptional regulator, TetR family, ev=1e-64, 58% identity TM1040:3.939..3.939 Mbp (675 bp) score=50
TM1040_3717 IclR family transcriptional regulator PFAM: regulatory proteins, IclR: (1.2e-15); KEGG: sil:SPO0768 transcriptional regulator, IclR family, ev=4e-89, 63% identity TM1040:3.977..3.978 Mbp (780 bp) score=50
TM1040_3723 GntR family transcriptional regulator PFAM: regulatory protein GntR, HTH: (3.2e-16) GntR-like: (3.1e-23); KEGG: sil:SPO0762 transcriptional regulator, GntR family, ev=2e-81, 71% identity TM1040:3.984..3.985 Mbp (651 bp) score=50
TM1040_3746 MerR family transcriptional regulator TIGRFAM: redox-sensitive transcriptional activator SoxR: (2.8e-64); PFAM: regulatory protein, MerR: (1.2e-08); KEGG: sil:SPO0314 redox-sensitive transcriptional activator SoxR, ev=4e-55, 68% identity TM1040:4.006..4.006 Mbp (456 bp) score=50
TM1040_3829 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (3e-16) LysR, substrate-binding: (1e-25); KEGG: mlo:mlr1832 probable transcriptional regulator, ev=7e-75, 51% identity TM1040:4.097..4.098 Mbp (879 bp) score=50
TM1040_3872 GntR family transcriptional regulator PFAM: regulatory protein GntR, HTH: (3.9e-20) GntR-like: (2.2e-32); KEGG: vpa:VPA1701 putative transcriptional regulatory protein, ev=2e-72, 57% identity TM1040:4.15..4.151 Mbp (732 bp) score=50
TM1040_0073 AraC family transcriptional regulator PFAM: helix-turn-helix, AraC type: (1.5e-08); KEGG: pst:PSPTO3805 transcriptional regulator, AraC family, ev=5e-11, 43% identity TM1040:75.57..76.28 kbp (714 bp) score=40
TM1040_0183 ferric uptake regulator PFAM: ferric-uptake regulator: (8.2e-15); KEGG: sil:SPOA0445 transcriptional regulator, Fur family, ev=5e-61, 81% identity TM1040:202.3..202.7 kbp (429 bp) score=40
TM1040_0207 HxlR family transcriptional regulator PFAM: helix-turn-helix, HxlR type: (9.1e-25); KEGG: ppr:PBPRB1657 hypothetical transcriptional regulator, ev=3e-36, 55% identity TM1040:225.1..225.5 kbp (372 bp) score=40
TM1040_0331 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (1e-15) LysR, substrate-binding: (2.9e-26); KEGG: sme:SMa0179 transcriptional activator, ev=2e-40, 38% identity TM1040:335.6..336.5 kbp (903 bp) score=40
TM1040_0332 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (1.6e-20) LysR, substrate-binding: (0.00013); KEGG: mlo:mlr1441 transcriptional activator protein AmpR, ev=8e-42, 42% identity TM1040:336.6..337.4 kbp (855 bp) score=40
TM1040_0405 two component, sigma54 specific, Fis family transcriptional regulator PFAM: response regulator receiver: (9.2e-27) sigma-54 factor, interaction region: (5.2e-95) helix-turn-helix, Fis-type: (1.8e-07) ATPase associated with various cellular activities, AAA_5: (0.00012); SMART: ATPase: (2.2e-10); KEGG: eba:ebA2951 sigma-54 dependent response regulator, ev=1e-116, 49% identity TM1040:414.9..416.3 kbp (1.353 kbp) score=40
TM1040_0562 LysR family transcriptional regulator TIGRFAM: Pca transcription factor PcaQ: (6e-133); PFAM: regulatory protein, LysR: (5.9e-20) LysR, substrate-binding: (1.1e-35); KEGG: sil:SPOA0047 pca operon transcriptional activator PcaQ, ev=4e-98, 60% identity TM1040:598.3..599.2 kbp (939 bp) score=40
TM1040_0576 CarD family transcriptional regulator PFAM: transcription factor CarD: (6.8e-33); KEGG: sil:SPO1420 transcriptional regulator, CarD family, ev=9e-83, 92% identity TM1040:613.6..614.1 kbp (510 bp) score=40
TM1040_0615 AsnC family transcriptional regulator PFAM: regulatory proteins, AsnC/Lrp: (5.6e-22); KEGG: sil:SPO0904 leucine-responsive regulatory protein, , ev=7e-80, 89% identity TM1040:655.6..656.1 kbp (501 bp) score=40
TM1040_0815 XRE family transcriptional regulator KEGG: rpa:RPA3130 transcriptional regulator, XRE family, ev=3e-30, 53% identity TM1040:858..858.4 kbp (372 bp) score=40
TM1040_0928 FUR family manganese uptake regulator PFAM: ferric-uptake regulator: (4.4e-58); KEGG: sil:SPO2477 transcriptional regulator, Fur family, ev=5e-62, 82% identity TM1040:991.6..992 kbp (417 bp) score=40
TM1040_1159 AsnC family transcriptional regulator PFAM: regulatory proteins, AsnC/Lrp: (1.7e-06); KEGG: sme:SMc02504 transcription regulator protein, ev=6e-13, 34% identity TM1040:1.25..1.251 Mbp (462 bp) score=40
TM1040_1190 DeoR family transcriptional regulator PFAM: sugar-binding region: (8.9e-68); KEGG: atc:AGR_L_1935 transcriptional regulator, ev=1e-101, 58% identity TM1040:1.28..1.281 Mbp (981 bp) score=40
TM1040_1196 AraC family transcriptional regulator PFAM: helix-turn-helix, AraC type: (1.3e-11); KEGG: sil:SPO1057 transcriptional regulator, AraC family, ev=1e-42, 32% identity TM1040:1.287..1.288 Mbp (1.011 kbp) score=40
TM1040_1270 transcriptional regulator PFAM: helix-turn-helix, AraC type: (1.1e-06) ThiJ/PfpI: (1.4e-09); KEGG: sil:SPO1941 transcriptional regulator, AraC family, ev=1e-149, 81% identity TM1040:1.368..1.369 Mbp (1.005 kbp) score=40
TM1040_1359 two component, sigma54 specific, Fis family transcriptional regulator PFAM: response regulator receiver: (1.9e-35) sigma-54 factor, interaction region: (3.8e-92) helix-turn-helix, Fis-type: (1.3e-09); SMART: ATPase: (2.4e-12); KEGG: sil:SPO2085 nitrogen assimilation regulatory protein NtrX, ev=0.0, 81% identity TM1040:1.451..1.453 Mbp (1.419 kbp) score=40
TM1040_1416 AraC family transcriptional regulator PFAM: helix-turn-helix, AraC type: (5.4e-08); KEGG: sil:SPO1660 transcriptional regulator, AraC family, ev=1e-50, 44% identity TM1040:1.509..1.51 Mbp (831 bp) score=40
TM1040_1447 GntR family transcriptional regulator PFAM: regulatory protein GntR, HTH: (5.9e-17) GntR-like: (1.2e-14); KEGG: jan:Jann_2385 regulatory protein GntR, HTH, ev=3e-94, 75% identity TM1040:1.545..1.546 Mbp (732 bp) score=40
TM1040_1510 XRE family transcriptional regulator PFAM: helix-turn-helix motif: (5e-13); KEGG: sil:SPO1022 transcriptional regulator, , ev=1e-145, 62% identity TM1040:1.616..1.617 Mbp (1.332 kbp) score=40
TM1040_1528 transcriptional regulator PFAM: helix-turn-helix, AraC type: (1.9e-09) ThiJ/PfpI: (0.0001); KEGG: sil:SPO1002 transcriptional regulator, AraC family, ev=1e-118, 60% identity TM1040:1.632..1.633 Mbp (1.008 kbp) score=40
TM1040_1694 AsnC family transcriptional regulator PFAM: regulatory proteins, AsnC/Lrp: (1.2e-20); KEGG: sil:SPO3009 proline dehydrogenase transcriptional activator, ev=2e-56, 67% identity TM1040:1.789..1.789 Mbp (477 bp) score=40
TM1040_1924 TetR family transcriptional regulator PFAM: regulatory protein, TetR: (1.3e-17); KEGG: sil:SPO1902 transcription regulator, TetR family, ev=6e-52, 58% identity TM1040:2.025..2.025 Mbp (570 bp) score=40
TM1040_2035 AraC family transcriptional regulator PFAM: helix-turn-helix, AraC type: (0.00031); KEGG: sil:SPO1161 transcriptional regulator, AraC family, ev=4e-70, 61% identity TM1040:2.144..2.144 Mbp (732 bp) score=40
TM1040_2058 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (1.3e-16) LysR, substrate-binding: (4.8e-32); KEGG: sme:SMa0750 probable LysR-family transcriptional activator, ev=2e-57, 40% identity TM1040:2.162..2.163 Mbp (915 bp) score=40
TM1040_2158 XRE family transcriptional regulator PFAM: helix-turn-helix motif: (4.1e-14) Cupin 2, conserved barrel: (4.7e-12); KEGG: ppr:PBPRB1321 transcriptional regulator, HTH_3family, ev=7e-34, 40% identity TM1040:2.267..2.268 Mbp (720 bp) score=40
TM1040_2189 transcriptional regulator PFAM: helix-turn-helix, AraC type: (5.6e-07) ThiJ/PfpI: (2.2e-05); KEGG: sil:SPO1434 transcriptional regulator, AraC family, ev=1e-138, 76% identity TM1040:2.299..2.3 Mbp (1.032 kbp) score=40
TM1040_2412 AraC family transcriptional regulator PFAM: helix-turn-helix, AraC type: (2.2e-09); KEGG: bur:Bcep18194_B2989 transcriptional regulator, AraC family, ev=1e-26, 28% identity TM1040:2.552..2.553 Mbp (1.161 kbp) score=40
TM1040_2422 CopY family transcriptional regulator PFAM: Penicillinase repressor: (1.4e-28); KEGG: sil:SPO0614 transcriptional regulator, , ev=6e-52, 80% identity TM1040:2.563..2.563 Mbp (450 bp) score=40
TM1040_2547 Crp/FNR family transcriptional regulator PFAM: cyclic nucleotide-binding: (5.5e-15) regulatory protein, Crp: (3.1e-11); KEGG: sil:SPO3531 transcriptional activator protein FnrL, ev=1e-113, 84% identity TM1040:2.689..2.689 Mbp (741 bp) score=40
TM1040_2695 AraC family transcriptional regulator PFAM: helix-turn-helix, AraC type: (2.4e-08); KEGG: sil:SPO3397 transcriptional regulator, AraC family, ev=4e-29, 28% identity TM1040:2.837..2.838 Mbp (1.011 kbp) score=40
TM1040_2714 XRE family transcriptional regulator PFAM: helix-turn-helix motif: (8.6e-16) Cupin 2, conserved barrel: (1.6e-17); KEGG: jan:Jann_2046 transcriptional regulator, XRE family with cupin sensor domain, ev=1e-74, 66% identity TM1040:2.859..2.86 Mbp (615 bp) score=40
TM1040_2747 RpiR family transcriptional regulator PFAM: helix-turn-helix protein RpiR: (1e-13) sugar isomerase (SIS): (1.2e-12); KEGG: bja:bll0307 transcriptional regulatory protein, ev=3e-48, 41% identity TM1040:2.895..2.896 Mbp (903 bp) score=40
TM1040_2797 transcriptional regulator PFAM: helix-turn-helix, AraC type: (8.6e-09) ThiJ/PfpI: (2.7e-05); KEGG: sil:SPOA0289 transcriptional regulator, AraC family, ev=5e-91, 60% identity TM1040:2.959..2.96 Mbp (948 bp) score=40
TM1040_3111 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (2.8e-21) LysR, substrate-binding: (7.3e-19); KEGG: reu:Reut_B4718 regulatory protein, LysR:LysR, substrate-binding, ev=7e-47, 36% identity TM1040:3.283..3.284 Mbp (960 bp) score=40
TM1040_3161 AraC family transcriptional regulator PFAM: helix-turn-helix, AraC type: (1e-07) transcription activator, effector binding: (9.1e-39); KEGG: sil:SPO3615 transcriptional regulator, AraC family, ev=1e-101, 64% identity TM1040:3.343..3.344 Mbp (834 bp) score=40
TM1040_3192 LysR family transcriptional regulator PFAM: LysR, substrate-binding: (1.3e-27); KEGG: sil:SPO0832 transcriptional regulator, LysR family, ev=3e-81, 57% identity TM1040:3.387..3.387 Mbp (807 bp) score=40
TM1040_3240 LysR family transcriptional regulator PFAM: regulatory protein, LysR: (7.9e-20) LysR, substrate-binding: (1.6e-60); KEGG: vpa:VPA0216 transcription regulator protein, ev=2e-82, 48% identity TM1040:3.442..3.442 Mbp (918 bp) score=40
TM1040_3266 periplasmic binding protein/LacI transcriptional regulator KEGG: jan:Jann_0882 periplasmic binding protein/LacI transcriptional regulator, ev=1e-145, 74% identity TM1040:3.469..3.469 Mbp (72 bp) score=40
TM1040_3293 transcriptional regulator PFAM: helix-turn-helix, AraC type: (9.1e-05) ThiJ/PfpI: (6.7e-06); KEGG: atc:AGR_pAT_bx241 transcriptional regulator homolog (GlxA), ev=1e-58, 43% identity TM1040:3.498..3.499 Mbp (972 bp) score=40
TM1040_3379 transcriptional regulator PFAM: helix-turn-helix, AraC type: (4.5e-06) ThiJ/PfpI: (0.00013); KEGG: sil:SPO1584 transcriptional regulator, AraC family, ev=2e-89, 51% identity TM1040:3.595..3.596 Mbp (1.014 kbp) score=40
TM1040_3409 AraC family transcriptional regulator PFAM: helix-turn-helix, AraC type: (5.8e-08); KEGG: sil:SPO1057 transcriptional regulator, AraC family, ev=4e-65, 40% identity TM1040:3.632..3.633 Mbp (1.02 kbp) score=40
TM1040_3642 GntR family transcriptional regulator PFAM: regulatory protein GntR, HTH: (4e-12) UbiC transcription regulator-associated: (2.2e-18); KEGG: rsp:RSP_2932 histidine utilization repressor, GntR family, ev=2e-42, 42% identity TM1040:3.9..3.901 Mbp (702 bp) score=40
TM1040_3777 XRE family transcriptional regulator PFAM: helix-turn-helix motif: (2e-07); KEGG: jan:Jann_1232 transcriptional regulator, XRE family, ev=2e-29, 54% identity TM1040:4.047..4.047 Mbp (378 bp) score=40
TM1040_3842 XRE family transcriptional regulator PFAM: helix-turn-helix motif: (1.4e-07); KEGG: ccr:CC1006 transcriptional regulator, Cro/CI family, ev=8e-25, 57% identity TM1040:4.113..4.113 Mbp (303 bp) score=40
TM1040_0136 response regulator receiver protein PFAM: response regulator receiver: (5.3e-09); KEGG: lic:LIC13330 response regulator, ev=4e-13, 32% identity TM1040:150.7..151.1 kbp (387 bp) score=30
TM1040_0636 response regulator receiver protein PFAM: response regulator receiver: (7e-21); KEGG: sil:SPO0931 response regulator, ev=6e-82, 66% identity TM1040:680.1..680.8 kbp (720 bp) score=30
TM1040_0829 response regulator receiver protein PFAM: response regulator receiver: (2.6e-05); KEGG: lic:LIC13330 response regulator, ev=8e-14, 35% identity TM1040:870.2..870.6 kbp (426 bp) score=30
TM1040_0912 MerR family transcriptional regulator PFAM: regulatory protein, MerR: (1.2e-08); KEGG: lma:LmjF35.0550 proteophosphoglycan ppg1, ev=2e-48, 23% identity TM1040:973..975.6 kbp (2.523 kbp) score=30
TM1040_1023 nitrogen regulatory protein P-II PFAM: nitrogen regulatory protein P-II: (3.9e-69); KEGG: sil:SPO2294 nitrogen regulatory protein P-II, ev=1e-53, 94% identity TM1040:1.095..1.095 Mbp (339 bp) score=30
TM1040_1029 response regulator receiver protein PFAM: response regulator receiver: (0.00011); KEGG: lic:LIC12088 response regulator, ev=2e-08, 31% identity TM1040:1.108..1.108 Mbp (384 bp) score=30
TM1040_1031 response regulator receiver protein PFAM: response regulator receiver: (4.1e-23); KEGG: ret:RHE_CH00624 probable two-component sensor histidine kinase/response regulator hybrid protein, ev=5e-18, 41% identity TM1040:1.11..1.111 Mbp (396 bp) score=30
TM1040_1215 response regulator receiver protein PFAM: response regulator receiver: (1.3e-13); KEGG: cps:CPS_3951 response regulator, ev=1e-25, 42% identity TM1040:1.304..1.304 Mbp (462 bp) score=30
TM1040_1361 two component, sigma54 specific, Fis family transcriptional regulator PFAM: response regulator receiver: (4.7e-39) sigma-54 factor, interaction region: (1.1e-40) helix-turn-helix, Fis-type: (1.6e-14); SMART: ATPase: (6.6e-08); KEGG: sil:SPO2087 nitrogen regulation protein NtrC, ev=0.0, 74% identity TM1040:1.455..1.457 Mbp (1.38 kbp) score=30
TM1040_1509 response regulator receiver protein PFAM: response regulator receiver: (5.6e-31); KEGG: sil:SPO1023 response regulator, ev=2e-47, 77% identity TM1040:1.615..1.616 Mbp (414 bp) score=30
TM1040_1998 response regulator receiver protein PFAM: response regulator receiver: (4.5e-19); KEGG: cps:CPS_3951 response regulator, ev=1e-26, 45% identity TM1040:2.103..2.103 Mbp (423 bp) score=30
TM1040_2032 AsnC family transcriptional regulator PFAM: regulatory proteins, AsnC/Lrp: (8.2e-12); KEGG: sil:SPO1164 hypothetical protein, ev=7e-36, 91% identity TM1040:2.142..2.142 Mbp (240 bp) score=30
nrdR transcriptional regulator NrdR TIGRFAM: Ribonucleotide reductase regulator NrdR-like: (5.4e-49); PFAM: ATP-cone: (2.1e-29); KEGG: sil:SPO1753 riboflavin biosynthesis protein RibX, ev=2e-83, 97% identity TM1040:2.243..2.243 Mbp (468 bp) score=30
TM1040_2174 response regulator receiver modulated diguanylate cyclase TIGRFAM: GGDEF domain: (1.1e-44); PFAM: GGDEF: (3.4e-58) response regulator receiver: (6.8e-11); KEGG: sil:SPO2753 diguanylate cyclase, /response regulator, ev=1e-115, 50% identity TM1040:2.287..2.288 Mbp (1.404 kbp) score=30
TM1040_2205 DeoR family transcriptional regulator PFAM: regulatory protein, DeoR: (1.3e-52) Helix-turn-helix, type 11: (5.4e-08); KEGG: sil:SPO0731 glycerol-3-phosphate regulon repressor, ev=7e-92, 69% identity TM1040:2.316..2.317 Mbp (795 bp) score=30
TM1040_2450 AraC family transcriptional regulator TIGRFAM: methylated-DNA--protein-cysteine methyltransferase: (2.3e-36); PFAM: helix-turn-helix, AraC type: (9.3e-08) methylated-DNA-[protein]-cysteine S-methyltransferase: (2.5e-35); KEGG: sil:SPO3578 ADA regulatory protein, ev=1e-115, 70% identity TM1040:2.591..2.592 Mbp (852 bp) score=30
TM1040_2589 GntR family transcriptional regulator PFAM: regulatory protein GntR, HTH: (3.8e-24) GntR-like: (1.1e-37); KEGG: sil:SPO3231 pyruvate dehydrogenase complex repressor, ev=2e-98, 70% identity TM1040:2.73..2.73 Mbp (768 bp) score=30
TM1040_2629 nitrogen regulatory protein P-II PFAM: nitrogen regulatory protein P-II: (2.7e-63); KEGG: jan:Jann_4056 nitrogen regulatory protein P-II (GlnB, GlnK), ev=4e-45, 82% identity TM1040:2.764..2.764 Mbp (339 bp) score=30
TM1040_2674 DeoR family transcriptional regulator PFAM: regulatory protein, DeoR: (2.7e-32) Helix-turn-helix, type 11: (1.5e-08); KEGG: pae:PA3583 glycerol-3-phosphate regulon repressor, ev=2e-39, 39% identity TM1040:2.81..2.811 Mbp (762 bp) score=30
TM1040_2682 DNA-O6-methylguanine--protein-cysteine S-methyltransferase/transcriptional regulator Ada KEGG: sil:SPO3311 ADA regulatory protein, , ev=1e-126, 65% identity; TIGRFAM: methylated-DNA--protein-cysteine methyltransferase: (4.4e-40); PFAM: methylated-DNA-[protein]-cysteine S-methyltransferase: (5e-36) Ada, metal-binding: (2.3e-37); SMART: Helix-turn-helix, AraC type: (1.2e-12) TM1040:2.82..2.821 Mbp (1.065 kbp) score=30
TM1040_2838 response regulator receiver protein PFAM: response regulator receiver: (4e-23); KEGG: sil:SPO3865 photosynthetic apparatus regulatory protein RegA, ev=8e-89, 89% identity TM1040:3.006..3.007 Mbp (555 bp) score=30
TM1040_2887 response regulator receiver modulated serine phosphatase PFAM: response regulator receiver: (3.3e-38) Stage II sporulation E: (1.8e-34); SMART: Protein phosphatase 2C-like: (1.8e-14); KEGG: sil:SPO0022 response regulator, ev=1e-177, 71% identity TM1040:3.056..3.057 Mbp (1.272 kbp) score=30
TM1040_3203 response regulator receiver protein PFAM: response regulator receiver: (9.1e-15); KEGG: rsp:RSP_2433 chemotaxis response regulator, CheY2, ev=8e-40, 60% identity TM1040:3.399..3.4 Mbp (387 bp) score=30
TM1040_3207 response regulator receiver protein PFAM: response regulator receiver: (3.3e-28); KEGG: jan:Jann_2842 response regulator receiver domain protein (CheY-like), ev=4e-36, 61% identity TM1040:3.403..3.404 Mbp (375 bp) score=30
TM1040_3300 response regulator receiver sensor signal transduction histidine kinase PFAM: response regulator receiver: (8.5e-14) ATP-binding region, ATPase-like: (3.8e-33) histidine kinase A-like: (0.00021); KEGG: ret:RHE_CH00624 probable two-component sensor histidine kinase/response regulator hybrid protein, ev=5e-45, 30% identity TM1040:3.508..3.509 Mbp (1.158 kbp) score=30
TM1040_3480 response regulator receiver protein PFAM: response regulator receiver: (0.00015); KEGG: lic:LIC12088 response regulator, ev=1e-10, 44% identity TM1040:3.713..3.713 Mbp (360 bp) score=30
TM1040_3532 LacI family transcriptional regulator PFAM: regulatory protein, LacI: (0.00039); KEGG: sco:SCO6986 DNA-binding protein, ev=9e-71, 44% identity TM1040:3.769..3.77 Mbp (1.02 kbp) score=30
TM1040_3643 Crp/FNR family transcriptional regulator PFAM: cyclic nucleotide-binding: (1.6e-13) regulatory protein, Crp: (1.9e-07); KEGG: sil:SPO1615 cyclic nucleotide-binding protein, ev=3e-56, 48% identity TM1040:3.901..3.902 Mbp (666 bp) score=30
TM1040_3671 PFAM: protein of unknown function UPF0074: (0.0005) regulatory protein, DeoR: (0.00099) Helix-turn-helix, type 11: (2.2e-10); KEGG: rba:RB4967 probable DeoR-family transcriptional regulator, ev=2e-81, 65% identity TM1040:3.925..3.926 Mbp (714 bp) score=30
TM1040_3808 LuxR family transcriptional regulator PFAM: regulatory protein, LuxR: (5.9e-05) TM1040:4.083..4.083 Mbp (801 bp) score=30
TM1040_0021 PTS transporter subunit IIA-like nitrogen-regulatory protein PtsN PFAM: phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2: (1.6e-16); KEGG: sil:SPO0077 PTS IIA-like nitrogen-regulatory protein PtsN, ev=2e-58, 74% identity TM1040:23.42..23.88 kbp (465 bp) score=20
TM1040_0112 TIGRFAM: PAS: (0.0022); PFAM: response regulator receiver: (2.5e-05) ATP-binding region, ATPase-like: (7.6e-29) histidine kinase A-like: (0.0016) PAS fold-4: (7.3e-06); KEGG: sil:SPO3297 sensory box histidine kinase/response regulator, ev=0.0, 69% identity TM1040:117.3..119.2 kbp (1.905 kbp) score=20
TM1040_0221 PFAM: response regulator receiver: (2.7e-25) ATP-binding region, ATPase-like: (3.4e-35) histidine kinase A-like: (5.6e-25); KEGG: ccr:CC3219 sensor histidine kinase/response regulator, ev=5e-75, 39% identity TM1040:236..237.5 kbp (1.431 kbp) score=20
TM1040_0342 PFAM: response regulator receiver: (1.3e-33) ATP-binding region, ATPase-like: (3.5e-39) histidine kinase A-like: (2e-27) CHASE: (3.1e-27) PAS fold-3: (4.2e-11) PAS fold-4: (2.1e-13) PAS fold: (2.8e-14); SMART: PAS: (6.5e-09) PAC motif: (3.9e-10); KEGG: sil:SPO0094 sensory box sensor histidine kinase/response regulator, ev=1e-146, 48% identity TM1040:347.3..349.7 kbp (2.484 kbp) score=20
TM1040_0367 PFAM: ROK: (2.8e-06) Helix-turn-helix, type 11: (0.0016); KEGG: ret:RHE_CH00464 sugar transcriptional regulator protein, ROK family, ev=1e-105, 45% identity TM1040:376.6..377.8 kbp (1.242 kbp) score=20
TM1040_0538 SARP family transcriptional regulator TM1040:570.6..571.4 kbp (801 bp) score=20
TM1040_0662 GcrA cell cycle regulator PFAM: GcrA cell cycle regulator: (2.2e-57); KEGG: sil:SPO0956 hypothetical protein, ev=3e-86, 81% identity TM1040:708.1..708.7 kbp (591 bp) score=20
TM1040_0872 XRE family transcriptional regulator TM1040:929.7..930.5 kbp (801 bp) score=20
TM1040_0895 TraR/DksA family transcriptional regulator TM1040:956..956.5 kbp (477 bp) score=20
TM1040_0962 PFAM: response regulator receiver: (7e-31) ATP-binding region, ATPase-like: (2.3e-39) histidine kinase A-like: (1e-21) Hpt: (6.2e-05) PAS fold-3: (0.00049) PAS fold-4: (0.00011) PAS fold: (4.3e-07); SMART: PAS: (2.2e-10); KEGG: sil:SPO0163 sensory box histidine kinase/response regulator, ev=1e-145, 41% identity TM1040:1.028..1.03 Mbp (2.472 kbp) score=20
TM1040_1100 XRE family transcriptional regulator TM1040:1.181..1.182 Mbp (765 bp) score=20
TM1040_1228 TIGRFAM: PAS: (7.2e-06); PFAM: response regulator receiver: (5.7e-17) ATP-binding region, ATPase-like: (6e-36) histidine kinase A-like: (2.7e-11); KEGG: sil:SPO2036 sensory box sensor histidine kianse/response regulator, ev=0.0, 64% identity TM1040:1.322..1.324 Mbp (2.31 kbp) score=20
TM1040_1240 BadM/Rrf2 family transcriptional regulator TM1040:1.335..1.336 Mbp (459 bp) score=20
TM1040_1253 RpiR family transcriptional regulator TM1040:1.348..1.349 Mbp (888 bp) score=20
TM1040_1258 phosphate uptake regulator PhoU PFAM: PhoU: (1.2e-29); KEGG: sil:SPO1952 phosphate transport system regulatory protein PhoU, ev=1e-93, 74% identity TM1040:1.355..1.356 Mbp (711 bp) score=20
TM1040_1345 XRE family transcriptional regulator TM1040:1.433..1.434 Mbp (630 bp) score=20
TM1040_1636 XRE family transcriptional regulator TM1040:1.742..1.742 Mbp (354 bp) score=20
TM1040_1733 XRE family transcriptional regulator TM1040:1.828..1.828 Mbp (402 bp) score=20
TM1040_1841 TIGRFAM: Polyhydroxyalkanoate synthesis repressor PhaR: (7e-66); PFAM: PHB accumulation regulatory: (5.5e-09) PHA accumulation regulator DNA-binding-like: (1.1e-39); KEGG: sil:SPO1294 polyhydroxyalkanoate synthesis repressor PhaR, ev=1e-84, 84% identity TM1040:1.943..1.943 Mbp (558 bp) score=20
TM1040_1854 PFAM: response regulator receiver: (5.7e-18) GAF: (1.2e-16) ATP-binding region, ATPase-like: (2.8e-39) histidine kinase A-like: (2.1e-21); KEGG: ccr:CC2988 sensor histidine kinase/response regulator, ev=2e-61, 38% identity TM1040:1.955..1.956 Mbp (1.74 kbp) score=20
TM1040_1879 XRE family transcriptional regulator TM1040:1.978..1.98 Mbp (1.476 kbp) score=20
TM1040_1909 XRE family transcriptional regulator TM1040:2.012..2.012 Mbp (372 bp) score=20
TM1040_1993 TraR/DksA family transcriptional regulator TM1040:2.099..2.099 Mbp (309 bp) score=20
TM1040_2008 HxlR family transcriptional regulator TM1040:2.113..2.114 Mbp (498 bp) score=20
TM1040_2184 XRE family transcriptional regulator TM1040:2.294..2.295 Mbp (870 bp) score=20
TM1040_2272 BadM/Rrf2 family transcriptional regulator TM1040:2.388..2.388 Mbp (465 bp) score=20
TM1040_2484 XRE family transcriptional regulator TM1040:2.623..2.624 Mbp (564 bp) score=20
TM1040_2653 transcriptional regulator CadC TM1040:2.787..2.788 Mbp (702 bp) score=20
TM1040_2746 PFAM: response regulator receiver: (1.7e-37) ATP-binding region, ATPase-like: (4.4e-36) histidine kinase, HAMP region: (1.8e-16) histidine kinase A-like: (6.4e-20); KEGG: vpa:VP2478 sensory box sensor histidine kinase/response regulator, ev=1e-157, 32% identity TM1040:2.892..2.895 Mbp (3.291 kbp) score=20
TM1040_2774 PFAM: response regulator receiver: (2.7e-27) ATP-binding region, ATPase-like: (4.6e-40) histidine kinase A-like: (1.3e-25); KEGG: sil:SPO0132 sensor histidine kinase/response regulator, ev=0.0, 65% identity TM1040:2.931..2.933 Mbp (2.286 kbp) score=20
TM1040_2788 RpiR family transcriptional regulator TM1040:2.948..2.949 Mbp (858 bp) score=20
TM1040_3025 XRE family transcriptional regulator TM1040:3.194..3.194 Mbp (567 bp) score=20
TM1040_3069 PFAM: protein of unknown function DUF179: (1.5e-86); KEGG: sil:SPO0296 transcriptional regulator, ev=2e-58, 63% identity TM1040:3.24..3.24 Mbp (621 bp) score=20
TM1040_3174 TIGRFAM: D-xylose ABC transporter, substrate-binding protein: (8.3e-198); PFAM: periplasmic binding protein/LacI transcriptional regulator: (0.0017); KEGG: sil:SPO0861 xylose ABC transporter, periplasmic xylose-binding protein, ev=1e-156, 81% identity TM1040:3.356..3.357 Mbp (1.029 kbp) score=20
TM1040_3261 XRE family transcriptional regulator TM1040:3.463..3.463 Mbp (573 bp) score=20
TM1040_3277 PFAM: response regulator receiver: (3.4e-31) ATP-binding region, ATPase-like: (2.4e-41) histidine kinase A-like: (6.6e-26); KEGG: ccr:CC3102 sensor histidine kinase/response regulator, ev=8e-78, 44% identity TM1040:3.479..3.481 Mbp (2.226 kbp) score=20
TM1040_3372 response regulator receiver protein PFAM: response regulator receiver: (0.00047); KEGG: eba:ebA6722 histidine kinase, ev=1e-11, 37% identity TM1040:3.587..3.587 Mbp (321 bp) score=20
TM1040_3402 transcriptional regulator TM1040:3.623..3.623 Mbp (591 bp) score=20
TM1040_3431 PFAM: response regulator receiver: (1.9e-30) ATP-binding region, ATPase-like: (1.9e-42) histidine kinase A-like: (1.1e-23) PAS fold-3: (4.6e-10) PAS fold-4: (8.8e-10) PAS fold: (3.1e-13); SMART: PAS: (3.6e-10) PAC motif: (1.9e-08); KEGG: sil:SPO0094 sensory box sensor histidine kinase/response regulator, ev=1e-156, 44% identity TM1040:3.655..3.658 Mbp (2.271 kbp) score=20
TM1040_3544 transcriptional regulator TM1040:3.785..3.785 Mbp (405 bp) score=20
TM1040_3609 RpiR family transcriptional regulator TM1040:3.861..3.862 Mbp (915 bp) score=20
TM1040_3615 ferric uptake regulator family protein KEGG: jan:Jann_0313 ferric uptake regulator, FUR family, ev=5e-57, 67% identity TM1040:3.871..3.871 Mbp (471 bp) score=20
TM1040_3622 PFAM: helix-turn-helix, Fis-type: (1.3e-14) GAF: (6e-13); KEGG: bmb:BruAb1_0196 transcriptional regulator, Fis family, ev=2e-72, 49% identity TM1040:3.88..3.881 Mbp (960 bp) score=20
TM1040_3737 DNA-binding transcriptional activator GcvA Glycine cleavage system transcriptional activator; activates the gcvTHP operon in the presence of glycine and represses the operon in its absence TM1040:3.997..3.998 Mbp (939 bp) score=20
TM1040_0065 anti-sigma regulatory factor, serine/threonine protein kinase TM1040:70.07..70.51 kbp (441 bp) score=10
TM1040_0139 anti-sigma regulatory factor, serine/threonine protein kinase TM1040:152.9..153.3 kbp (423 bp) score=10
TM1040_0141 PFAM: Sulfate transporter/antisigma-factor antagonist STAS: (3.7e-11); KEGG: nfa:nfa32110 sigma activity regulator, ev=4e-31, 40% identity TM1040:153.7..154.6 kbp (897 bp) score=10
ihfB This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control TM1040:221.1..221.4 kbp (288 bp) score=10
TM1040_0416 TIGRFAM: Anti-sigma factor ChrR , : (6.8e-79); KEGG: sil:SPO1479 transcriptional activator, , ev=1e-71, 61% identity TM1040:426.2..426.9 kbp (636 bp) score=10
TM1040_0446 catalyzes the uridylylation or deuridylylation of the PII nitrogen regulatory protein TM1040:462.5..465.2 kbp (2.682 kbp) score=10
ilvH acetolactate synthase 3 regulatory subunit TM1040:931.3..931.9 kbp (561 bp) score=10
ihfA This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control TM1040:975.6..975.9 kbp (303 bp) score=10
TM1040_0963 PFAM: Sulfate transporter/antisigma-factor antagonist STAS: (1e-16); KEGG: vvy:VVA0580 anti-anti-sigma regulatory factor, ev=4e-33, 26% identity TM1040:1.031..1.032 Mbp (927 bp) score=10
TM1040_1147 Catalyzes a key regulatory step in fatty acid biosynthesis TM1040:1.235..1.236 Mbp (807 bp) score=10
TM1040_1916 N-acetylmuramyl-L-alanine amidase, negative regulator of AmpC, AmpD TM1040:2.018..2.019 Mbp (660 bp) score=10
TM1040_2086 Produces ATP from ADP in the presence of a proton gradient across the membrane. The beta chain is a regulatory subunit TM1040:2.189..2.191 Mbp (1.425 kbp) score=10
TM1040_2087 Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is a regulatory subunit TM1040:2.191..2.192 Mbp (876 bp) score=10
TM1040_2348 response regulator receiver protein TM1040:2.469..2.47 Mbp (1.245 kbp) score=10
rpmE RpmE; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially growing Bacilli while YtiA was found after exponential growth; expression of ytiA is controlled by a zinc-specific transcriptional repressor; RpmE contains one zinc ion and a CxxC motif is responsible for this binding; forms an RNP particle along with proteins L5, L18, and L25 and 5S rRNA; found crosslinked to L2 and L25 and EF-G; may be near the peptidyltransferase site of the 50S ribosome TM1040:2.75..2.75 Mbp (222 bp) score=10
TM1040_2722 two-component response regulator TM1040:2.865..2.866 Mbp (822 bp) score=10
TM1040_2839 PFAM: electron transport protein SCO1/SenC: (5.6e-30); KEGG: sil:SPO3866 regulatory protein SenC, ev=5e-85, 74% identity TM1040:3.007..3.007 Mbp (624 bp) score=10
hrcA Negative regulator of class I heat shock genes (grpE-dnaK-dnaJ and groELS operons). Prevents heat-shock induction of these operons TM1040:3.041..3.042 Mbp (1.065 kbp) score=10
flbT post-transcriptional repressor of flagellum biosynthesis; promotes degradation of fljK mRNA: Bradyrhizobium has one thick flagellum and several thin flagella; the protein in this cluster is associated with the thin flagella TM1040:3.138..3.139 Mbp (405 bp) score=10
flaF flagellar biosynthesis regulatory protein FlaF TM1040:3.139..3.139 Mbp (372 bp) score=10
TM1040_3231 PFAM: response regulator receiver: (0.00049) ATP-binding region, ATPase-like: (7.1e-24) histidine kinase, HAMP region: (2.7e-14) histidine kinase A-like: (1.7e-06); KEGG: ypk:y3864 hypothetical protein, ev=1e-66, 26% identity TM1040:3.432..3.434 Mbp (2.475 kbp) score=10
TM1040_3254 periplasmic sensory protein associated with the TorRS two-component regulatory system TM1040:3.456..3.457 Mbp (1.071 kbp) score=10
TM1040_3254 periplasmic sensory protein associated with the TorRS two-component regulatory system TM1040:3.456..3.457 Mbp (1.071 kbp) score=10
TM1040_3336 PFAM: ATP-binding region, ATPase-like: (1.9e-24) histidine kinase, HAMP region: (6.2e-08) histidine kinase A-like: (2.8e-15); KEGG: bja:blr7620 two-component hybrid sensor and regulator, ev=1e-95, 40% identity TM1040:3.547..3.549 Mbp (1.563 kbp) score=10
TM1040_3366 response regulator receiver protein TM1040:3.578..3.579 Mbp (846 bp) score=10
TM1040_3612 PFAM: response regulator receiver: (1.8e-28) ATP-binding region, ATPase-like: (3.5e-38) histidine kinase A-like: (2.4e-27); KEGG: mlo:mll3725 hybrid sensory histidine kinase, ev=1e-118, 44% identity TM1040:3.867..3.867 Mbp (105 bp) score=10
TM1040_3656 TenA family transcription regulator TM1040:3.911..3.912 Mbp (678 bp) score=10
- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks
For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70