Roseobase: Ruegeria sp. TM1040

- Instructions

Searching: Search using a sequence name, gene name, locus, oligonucleotide (15 bp minimum), or other landmark. The wildcard character * is allowed.
Navigation: Click one of the rulers to center on a location, or click and drag to select a region. Use the Scroll/Zoom buttons to change magnification and position.

Examples: TM1040:3819290..3822502, TM1040_3663, IPR000445, dmdA, TM1040_R0002, TM1040_R0026, TM1040_R0028, transcriptional regulator, MANSPQAKKRARQNEKRFAINKARRSRIRTFLRKVEEAIASGDKEA.

[Bookmark this] [Upload your own data] [Hide banner] [Share these tracks] [Link to Image] [High-res Image] [Help] [Reset]
- Search
Landmark or Region:
Reports & Analysis:
  
Data Source
The following 95 regions match your request.
Matches on TM1040
overview_TM1040
TM1040_1763 translation initiation factor 3 TIGRFAM: translation initiation factor IF-3: (1.6e-46); PFAM: initiation factor 3: (3.1e-54); KEGG: sil:SPO2638 translation initiation factor IF-3, ev=3e-70, 93% identity TM1040:1.854..1.854 Mbp (414 bp) score=110
rpoH2 RNA polymerase factor sigma-32 binds with the catalytic core of RNA polymerase to produce the holoenzyme; sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released; sigma-32 is responsible for the expression of heat shock promoters; there are paralogs in Rhizobium and Sinorhizobium; the proteins in this cluster act as secondary heat shock sigma factors; the Rhizobium sigma-32 factor may also be involved in exopolysaccharide production TM1040:473.3..474.2 kbp (879 bp) score=70
frr ribosome recycling factor Rrf; Frr; ribosome-recycling factor; release factor 4; RF4; recycles ribosomes upon translation termination along with release factor RF-3 and elongation factor EF-G; A GTPase-dependent process results in release of 50S from 70S; inhibited by release factor RF-1; essential for viability; structurally similar to tRNAs TM1040:1.507..1.507 Mbp (564 bp) score=70
TM1040_2141 RNA polymerase sigma factor RpoD sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released; this is the primary sigma factor of bacteria TM1040:2.246..2.248 Mbp (1.995 kbp) score=60
TM1040_1807 peptide chain release factor 3 TIGRFAM: peptide chain release factor 3: (2.8e-226) Small GTP-binding protein domain: (3.3e-17); PFAM: protein synthesis factor, GTP-binding: (3.7e-54) elongation factor Tu, domain 2: (2.2e-07); KEGG: sil:SPO2695 peptide chain release factor 3, ev=0.0, 91% identity TM1040:1.898..1.899 Mbp (1.689 kbp) score=50
infA translation initiation factor IF-1 stimulates the activities of the other two initiation factors, IF-2 and IF-3 TM1040:3.802..3.802 Mbp (219 bp) score=50
TM1040_0066 anti-sigma-factor antagonist TIGRFAM: anti-anti-sigma factor: (1.8e-12); PFAM: Sulfate transporter/antisigma-factor antagonist STAS: (9.8e-21); KEGG: sil:SPO3409 anti-anti-sigma factor, ev=4e-40, 78% identity TM1040:70.54..70.89 kbp (345 bp) score=40
TM1040_1349 transcription-repair coupling factor TIGRFAM: transcription-repair coupling factor: (0); PFAM: helicase-like: (1.8e-17) transcription factor CarD: (1.9e-42) TRCF: (1e-44) type III restriction enzyme, res subunit: (8.4e-07) DEAD/DEAH box helicase-like: (4.2e-34); KEGG: sil:SPO2074 transcription-repair coupling factor, ev=0.0, 86% identity TM1040:1.437..1.441 Mbp (3.45 kbp) score=40
infB translation initiation factor IF-2 Protects formylmethionyl-tRNA from spontaneous hydrolysis and promotes its binding to the 30S ribosomal subunits during initiation of protein synthesis. Also involved in the hydrolysis of GTP during the formation of the 70S ribosomal complex TM1040:3.079..3.082 Mbp (2.508 kbp) score=40
ihfB integration host factor subunit beta This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control TM1040:221.1..221.4 kbp (288 bp) score=30
TM1040_0224 translation-associated GTPase; the crystal structure of the Haemophilus influenzae YchF protein showed similarity to the yeast structure (PDB: 1NI3); fluorescence spectroscopy revealed nucleic acid binding; the yeast protein YBR025c interacts with the translation elongation factor eEF1 TM1040:239.2..240.3 kbp (1.098 kbp) score=30
rplL present in two forms; L12 is normal, while L7 is aminoacylated at the N-terminal serine; the only multicopy ribosomal protein; 4:1 ratio of L7/L12 per ribosome; two L12 dimers bind L10; critically important for translation efficiency and fidelity; stimulates GTPase activity of translation factors TM1040:247..247.4 kbp (378 bp) score=30
TM1040_0415 RNA polymerase sigma factor RpoE Member of the extracytoplasmic function sigma factors which are active under specific conditions; binds with the catalytic core of RNA polymerase to produce the holoenzyme and directs bacterial core RNA polymerase to specific promoter elements to initiate transcription; this sigma factor is involved in heat shock and oxidative stress response TM1040:425.6..426.2 kbp (597 bp) score=30
prfB peptide chain release factor 2 recognizes the termination signals UGA and UAA during protein translation a specificity which is dependent on amino acid residues residing in loops of the L-shaped tRNA-like molecule of RF2; in some organisms control of PrfB protein levels is maintained through a +1 ribosomal frameshifting mechanism; this protein is similar to release factor 1 TM1040:924.8..925.9 kbp (1.125 kbp) score=30
ihfA integration host factor subunit alpha This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control TM1040:975.6..975.9 kbp (303 bp) score=30
prfA peptide chain release factor 1 recognizes the termination signals UAG and UAA during protein translation a specificity which is dependent on amino acid residues residing in loops of the L-shaped tRNA-like molecule of RF1; this protein is similar to release factor 2 TM1040:1.004..1.005 Mbp (1.053 kbp) score=30
TM1040_0963 anti-sigma-factor antagonist PFAM: Sulfate transporter/antisigma-factor antagonist STAS: (1e-16); KEGG: vvy:VVA0580 anti-anti-sigma regulatory factor, ev=4e-33, 26% identity TM1040:1.031..1.032 Mbp (927 bp) score=30
TM1040_1235 TIGRFAM: Small GTP-binding protein domain: (1.5e-22) GTP-binding protein TypA: (0); PFAM: elongation factor G-like: (1.3e-23) protein synthesis factor, GTP-binding: (1.7e-72) elongation factor Tu, domain 2: (3e-08); KEGG: sil:SPO2031 GTP-binding protein TypA, ev=0.0, 90% identity TM1040:1.331..1.333 Mbp (1.821 kbp) score=30
TM1040_1891 chromosome replication initiation inhibitor protein specific inhibitor of chromosomal initiation of replication in vitro; binds the three 13-mers in the origin (oriC) to block initiation of replication; also controls genes involved in arginine transport TM1040:1.992..1.993 Mbp (921 bp) score=30
TM1040_2127 NusB antitermination factor TIGRFAM: transcription antitermination factor NusB: (4.4e-28); PFAM: NusB/RsmB/TIM44: (2.2e-22); KEGG: sil:SPO1763 transcription antitermination factor NusB, ev=2e-64, 76% identity TM1040:2.233..2.233 Mbp (483 bp) score=30
TM1040_2177 RNA polymerase sigma factor Bacteria have multiple sigma factors which are active under specific conditions; the sigma factor binds with the catalytic core of RNA polymerase to produce the holoenzyme and directs bacterial core RNA polymerase to specific promoter elements to initiate transcription TM1040:2.289..2.29 Mbp (627 bp) score=30
TM1040_2723 RNA polymerase sigma factor Bacteria have multiple sigma factors which are active under specific conditions; the sigma factor binds with the catalytic core of RNA polymerase to produce the holoenzyme and directs bacterial core RNA polymerase to specific promoter elements to initiate transcription TM1040:2.866..2.867 Mbp (558 bp) score=30
TM1040_3064 molybdenum cofactor biosynthesis protein B TIGRFAM: Molybdenum cofactor biosynthesis protein B, proteobacteria: (2.6e-101); PFAM: molybdopterin binding domain: (2.2e-36); KEGG: sil:SPO0291 molybdenum cofactor biosynthesis protein B, ev=3e-84, 83% identity TM1040:3.233..3.233 Mbp (543 bp) score=30
TM1040_3225 von Willebrand factor, type A PFAM: von Willebrand factor, type A: (2e-06); KEGG: sil:SPO2221 von Willebrand factor type A domain protein, ev=3e-84, 41% identity TM1040:3.424..3.425 Mbp (1.434 kbp) score=30
TM1040_3784 RNA polymerase sigma factor Bacteria have multiple sigma factors which are active under specific conditions; the sigma factor binds with the catalytic core of RNA polymerase to produce the holoenzyme and directs bacterial core RNA polymerase to specific promoter elements to initiate transcription TM1040:4.055..4.055 Mbp (555 bp) score=30
dnaA chromosomal replication initiation protein binds to the dnaA-box as an ATP-bound complex at the origin of replication during the initiation of chromosomal replication; can also affect transcription of multiple genes including itself. TM1040:45 bp..1.457 kbp (1.413 kbp) score=20
TM1040_0065 anti-sigma regulatory factor, serine/threonine protein kinase PFAM: ATP-binding region, ATPase-like: (0.00013); KEGG: sil:SPO3410 anti-sigma B factor, , ev=5e-37, 54% identity TM1040:70.07..70.51 kbp (441 bp) score=20
TM1040_0140 anti-sigma-factor antagonist PFAM: Sulfate transporter/antisigma-factor antagonist STAS: (3.6e-10); KEGG: mpa:MAP0378c hypothetical protein, ev=1e-24, 54% identity TM1040:153.3..153.7 kbp (357 bp) score=20
TM1040_0141 anti-sigma-factor antagonist PFAM: Sulfate transporter/antisigma-factor antagonist STAS: (3.7e-11); KEGG: nfa:nfa32110 sigma activity regulator, ev=4e-31, 40% identity TM1040:153.7..154.6 kbp (897 bp) score=20
TM1040_0151 ECF subfamily RNA polymerase sigma-24 factor PFAM: sigma-70 region 2: (1.8e-16) sigma-70 region 4: (1.4e-06) Sigma-70, region 4 type 2: (2.5e-15); KEGG: rpa:RPA1116 RNA polymerase ECF-type sigma factor, ev=4e-88, 55% identity TM1040:166.2..167.1 kbp (879 bp) score=20
TM1040_0227 KEGG: sil:SPO3516 transcription termination/antitermination factor NusG, ev=2e-85, 87% identity; TIGRFAM: transcription termination/antitermination factor NusG: (9.3e-79); PFAM: transcription antitermination protein NusG: (4.7e-41) KOW: (4.4e-09); SMART: NGN: (3.2e-36) KOW (Kyrpides, Ouzounis, Woese) motif: (2.8e-06) TM1040:241.9..242.4 kbp (534 bp) score=20
TM1040_0241 elongation factor G EF-G; promotes GTP-dependent translocation of the ribosome during translation; many organisms have multiple copies of this gene TM1040:260..262.1 kbp (2.121 kbp) score=20
TM1040_0242 elongation factor Tu EF-Tu; promotes GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis; when the tRNA anticodon matches the mRNA codon, GTP hydrolysis results; the inactive EF-Tu-GDP leaves the ribosome and release of GDP is promoted by elongation factor Ts; many prokaryotes have two copies of the gene encoding EF-Tu TM1040:262.2..263.4 kbp (1.176 kbp) score=20
TM1040_0416 anti-ECF sigma factor ChrR TIGRFAM: Anti-sigma factor ChrR , : (6.8e-79); KEGG: sil:SPO1479 transcriptional activator, , ev=1e-71, 61% identity TM1040:426.2..426.9 kbp (636 bp) score=20
TM1040_0497 molybdenum cofactor sulfurylase PFAM: protein of unknown function DUF182: (8.2e-12); KEGG: sil:SPO0652 xanthine dehydrogenase accessory factor, ev=1e-107, 61% identity TM1040:520.4..521.4 kbp (936 bp) score=20
TM1040_0563 RNA polymerase factor sigma-32 binds with the catalytic core of RNA polymerase to produce the holoenzyme; this sigma factor is responsible for the expression of heat shock promoters TM1040:599.6..600.5 kbp (900 bp) score=20
TM1040_0612 in Rhizobium meliloti this protein is involved in the synthesis of nodulation factors that are active on the roots of alfalfa; catalyzes formation of activated sulfate intermediate; converts ATP and sulfate to diphosphate and adenylylsulfate and then ATP and adenylyl sulfate to ADP and 3'-phosphoadenylyl sulfate; the activated intermediate is transferred to the nodulation factors by NodH; may interact with NodP and NodQ; similar to the CysD and CysN proteins from Escherichia coli involved in cysteine biosynthesis TM1040:650.5..652.2 kbp (1.719 kbp) score=20
ksgA catalyzes the transfer of a total of four methyl groups from S-adenosyl-l-methionine (S-AdoMet) to two adjacent adenosine bases A1518 and A1519 in 16S rRNA; mutations in ksgA causes resistance to the translation initiation inhibitor kasugamycin TM1040:1.007..1.007 Mbp (843 bp) score=20
moaC molybdenum cofactor biosynthesis protein MoaC MoaC; along with MoaA is involved in conversion of a guanosine derivative into molybdopterin precursor Z; involved in molybdenum cofactor biosynthesis TM1040:1.224..1.224 Mbp (471 bp) score=20
tsf elongation factor Ts EF-Ts; functions during elongation stage of protein translation; forms a dimer; associates with EF-Tu-GDP complex and promotes exchange of GDP to GTP resulting in regeneration of the active form of EF-Tu TM1040:1.3..1.301 Mbp (876 bp) score=20
TM1040_2434 elongation factor Tu EF-Tu; promotes GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis; when the tRNA anticodon matches the mRNA codon, GTP hydrolysis results; the inactive EF-Tu-GDP leaves the ribosome and release of GDP is promoted by elongation factor Ts; many prokaryotes have two copies of the gene encoding EF-Tu TM1040:2.574..2.575 Mbp (1.176 kbp) score=20
TM1040_2754 PFAM: Endoribonuclease L-PSP: (4.9e-36); KEGG: sme:SMb21139 protein, similar to translation initiation inhibitors, ev=4e-35, 56% identity TM1040:2.903..2.903 Mbp (390 bp) score=20
TM1040_3060 translation factor SUA5 TM1040:3.23..3.231 Mbp (972 bp) score=20
TM1040_3632 TIGRFAM: molybdopterin converting factor, subunit 1: (5.7e-33); PFAM: thiamineS: (2.2e-19); KEGG: rsp:RSP_1072 molybdopterin MPT converting factor, subunit 1 protein, ev=2e-33, 86% identity TM1040:3.891..3.891 Mbp (246 bp) score=20
greA transcription elongation factor GreA necessary for efficient RNA polymerase transcription elongation past template-encoded arresting sites; arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by cleavage factors such as GreA or GreB allows the resumption of elongation from the new 3'terminus TM1040:4.007..4.008 Mbp (471 bp) score=20
TM1040_3856 RNA polymerase ECF-subfamily sigma factor PFAM: sigma-70 region 2: (2.9e-08) Sigma-70, region 4 type 2: (7.9e-08); KEGG: sma:SAV1195 putative RNA polymerase ECF-subfamily sigma factor, ev=2e-76, 44% identity TM1040:4.131..4.132 Mbp (1.248 kbp) score=20
rpsO primary rRNA binding protein; helps nucleate assembly of 30S; binds directly to the 16S rRNA and an intersubunit bridge to the 23S rRNA; autoregulates translation through interactions with the mRNA leader sequence TM1040:85..85.27 kbp (270 bp) score=10
rbfA ribosome-binding factor A TM1040:89.2..89.6 kbp (396 bp) score=10
TM1040_0139 anti-sigma regulatory factor, serine/threonine protein kinase TM1040:152.9..153.3 kbp (423 bp) score=10
TM1040_0214 Enables the recycling of peptidyl-tRNAs produced at termination of translation TM1040:230.2..230.9 kbp (747 bp) score=10
rpoB DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates; beta subunit is part of the catalytic core which binds with a sigma factor to produce the holoenzyme TM1040:247.7..251.9 kbp (4.14 kbp) score=10
TM1040_0235 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Subunit beta' binds to sigma factor allowing it to bind to the -10 region of the promoter TM1040:251.9..256.1 kbp (4.233 kbp) score=10
rpsC forms a complex with S10 and S14; binds the lower part of the 30S subunit head and the mRNA in the complete ribosome to position it for translation TM1040:270.4..271.2 kbp (720 bp) score=10
rpsQ primary binding protein; helps mediate assembly; involved in translation fidelity TM1040:276..276.2 kbp (231 bp) score=10
rpsE located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body; contacts S4 and S8; with S4 and S12 plays a role in translational accuracy; mutations in this gene result in spectinomycin resistance TM1040:279.4..279.9 kbp (564 bp) score=10
TM1040_0288 recombination factor protein RarA TM1040:294.2..295.5 kbp (1.332 kbp) score=10
TM1040_0405 PFAM: response regulator receiver: (9.2e-27) sigma-54 factor, interaction region: (5.2e-95) helix-turn-helix, Fis-type: (1.8e-07) ATPase associated with various cellular activities, AAA_5: (0.00012); SMART: ATPase: (2.2e-10); KEGG: eba:ebA2951 sigma-54 dependent response regulator, ev=1e-116, 49% identity TM1040:414.9..416.3 kbp (1.353 kbp) score=10
TM1040_0445 TIGRFAM: integral membrane protein MviN: (6.6e-117); PFAM: virulence factor MVIN-like: (3e-113); KEGG: sil:SPO0396 integral membrane protein MviN, ev=0.0, 74% identity TM1040:461..462.5 kbp (1.548 kbp) score=10
TM1040_0562 TIGRFAM: Pca transcription factor PcaQ: (6e-133); PFAM: regulatory protein, LysR: (5.9e-20) LysR, substrate-binding: (1.1e-35); KEGG: sil:SPOA0047 pca operon transcriptional activator PcaQ, ev=4e-98, 60% identity TM1040:598.3..599.2 kbp (939 bp) score=10
TM1040_0576 PFAM: transcription factor CarD: (6.8e-33); KEGG: sil:SPO1420 transcriptional regulator, CarD family, ev=9e-83, 92% identity TM1040:613.6..614.1 kbp (510 bp) score=10
TM1040_0642 PFAM: Cobalt chelatase, CobT subunit: (3.5e-268); SMART: von Willebrand factor, type A: (2.1e-10); KEGG: sil:SPO2855 cobalt chelatase, pCobT subunit, ev=0.0, 84% identity TM1040:686..687.9 kbp (1.878 kbp) score=10
moaA molybdenum cofactor biosynthesis protein A TM1040:781.4..782.4 kbp (1.008 kbp) score=10
ilvH with IlvI catalyzes the formation of 2-acetolactate from pyruvate, the small subunit is required for full activity and valine sensitivity; E.coli produces 3 isoenzymes of acetolactate synthase which differ in specificity to substrates, valine sensitivity and affinity for cofactors; also known as acetolactate synthase 3 small subunit TM1040:931.3..931.9 kbp (561 bp) score=10
tig trigger factor TM1040:1.113..1.114 Mbp (1.332 kbp) score=10
TM1040_1136 PFAM: molybdopterin binding domain: (8e-37) MoeA-like, domain I and II: (2.7e-56) MoeA-like, domain IV: (1.3e-15); KEGG: sil:SPO2153 molybdenum cofactor biosynthesis protein A, ev=1e-150, 70% identity TM1040:1.223..1.224 Mbp (1.173 kbp) score=10
rpmA involved in the peptidyltransferase reaction during translation TM1040:1.292..1.292 Mbp (270 bp) score=10
TM1040_1240 PFAM: protein of unknown function UPF0074: (1.8e-40); KEGG: sil:SPO2025 iron-sulfur cluster assembly transcription factor IscR, , ev=2e-71, 88% identity TM1040:1.335..1.336 Mbp (459 bp) score=10
TM1040_1359 PFAM: response regulator receiver: (1.9e-35) sigma-54 factor, interaction region: (3.8e-92) helix-turn-helix, Fis-type: (1.3e-09); SMART: ATPase: (2.4e-12); KEGG: sil:SPO2085 nitrogen assimilation regulatory protein NtrX, ev=0.0, 81% identity TM1040:1.451..1.453 Mbp (1.419 kbp) score=10
TM1040_1361 PFAM: response regulator receiver: (4.7e-39) sigma-54 factor, interaction region: (1.1e-40) helix-turn-helix, Fis-type: (1.6e-14); SMART: ATPase: (6.6e-08); KEGG: sil:SPO2087 nitrogen regulation protein NtrC, ev=0.0, 74% identity TM1040:1.455..1.457 Mbp (1.38 kbp) score=10
rpsI forms a direct contact with the tRNA during translation TM1040:1.479..1.48 Mbp (486 bp) score=10
miaA IPP transferase; isopentenyltransferase; involved in tRNA modification; in Escherichia coli this enzyme catalyzes the addition of a delta2-isopentenyl group from dimethylallyl diphosphate to the N6-nitrogen of adenosine adjacent to the anticodon of tRNA species that read codons starting with uracil; further tRNA modifications may occur; mutations in miaA result in defects in translation efficiency and fidelity TM1040:1.508..1.509 Mbp (867 bp) score=10
TM1040_1461 PFAM: response regulator receiver: (5.5e-44) sigma-54 factor, interaction region: (1.6e-28) helix-turn-helix, Fis-type: (9.6e-07) ATPase associated with various cellular activities, AAA_5: (0.00016); SMART: ATPase: (9.8e-10); KEGG: sil:SPO1892 C4-dicarboxylate transport transcriptional regulatory protein DctD, ev=0.0, 92% identity TM1040:1.561..1.563 Mbp (1.338 kbp) score=10
TM1040_1550 catalyzes the conversion of dihydroorotate to orotate in the pyrimidine biosynthesis pathway; uses a flavin nucleotide as an essential cofactor; class 2 enzymes are monomeric and compared to the class 1 class 2 possess an extended N terminus, which plays a role in the membrane association of the enzyme and provides the binding site for the respiratory quinones that serve as physiological electron acceptors TM1040:1.657..1.658 Mbp (1.059 kbp) score=10
TM1040_1769 von Willebrand factor A TM1040:1.861..1.862 Mbp (1.284 kbp) score=10
TM1040_1814 PFAM: response regulator receiver: (1.8e-31) sigma-54 factor, interaction region: (6.1e-23) helix-turn-helix, Fis-type: (1.1e-08); KEGG: sil:SPO2629 C4-dicarboxylate transport transcriptional regulatory protein, ev=1e-161, 71% identity TM1040:1.906..1.908 Mbp (1.23 kbp) score=10
TM1040_1987 elongation factor P TM1040:2.092..2.092 Mbp (564 bp) score=10
rpsD primary rRNA binding protein; nucleates 30S assembly; involved in translational accuracy with proteins S5 and S12; interacts with protein S5; involved in autogeneously regulating ribosomal proteins by binding to pseudoknot structures in the polycistronic mRNA; interacts with transcription complex and functions similar to protein NusA in antitermination TM1040:2.212..2.212 Mbp (621 bp) score=10
gltX Charges one glutamine molecule and pairs it to its corresponding RNA trinucleotide during protein translation TM1040:2.39..2.392 Mbp (1.326 kbp) score=10
gltX Charges one glutamine molecule and pairs it to its corresponding RNA trinucleotide during protein translation TM1040:2.39..2.392 Mbp (1.326 kbp) score=10
TM1040_2321 PFAM: Sulfate transporter/antisigma-factor antagonist STAS: (0.00075) Xanthine/uracil/vitamin C permease: (8.4e-05) sulphate transporter: (1.3e-68); KEGG: sil:SPO3058 sulfate transporter family protein, ev=0.0, 80% identity TM1040:2.441..2.443 Mbp (1.611 kbp) score=10
TM1040_2467 PFAM: molybdopterin binding domain: (3.9e-42); KEGG: sil:SPO3759 molybdenum cofactor biosynthesis domain protein, ev=1e-112, 84% identity TM1040:2.608..2.609 Mbp (723 bp) score=10
TM1040_2468 Regulatory factor involved in maltose metabolism TM1040:2.609..2.609 Mbp (717 bp) score=10
smpB binds to ssrA RNA (tmRNA) and is required for its successful binding to ribosomes; also appears to function in the trans-translation step by promoting accommodation of tmRNA into the ribosomal A site; SmpB protects the tmRNA from RNase R degradation in Caulobacter crescentus; both the tmRNA and SmpB are regulated in cell cycle-dependent manner; functions in release of stalled ribosomes from damaged mRNAs and targeting proteins for degradation TM1040:2.622..2.622 Mbp (477 bp) score=10
TM1040_2666 PFAM: Class I peptide chain release factor: (4.9e-17); KEGG: sil:SPO0127 peptidyl-tRNA hydrolase domain protein, ev=2e-56, 77% identity TM1040:2.802..2.802 Mbp (420 bp) score=10
TM1040_2706 PFAM: protein of unknown function DUF182: (5.2e-12); KEGG: mlo:mlr5136 xanthine dehydrogenase accessory factor, ev=4e-64, 46% identity TM1040:2.85..2.851 Mbp (852 bp) score=10
rho transcription termination factor Rho TM1040:3.031..3.033 Mbp (1.272 kbp) score=10
nusA transcription elongation factor NusA TM1040:3.077..3.079 Mbp (1.617 kbp) score=10
flaF acts as an activator of flagellin translation and may be required for filament secretion or assembly; Bradyrhizobium has one thick flagellum and several thin flagella; the Bradyrhizobium protein in this cluster is associated with the thick flagellum TM1040:3.139..3.139 Mbp (372 bp) score=10
rpsT binds directly to the 16S rRNA and is involved in post-translational inhibition of arginine and ornithine decarboxylase TM1040:3.2..3.2 Mbp (264 bp) score=10
TM1040_3407 PFAM: initiator RepB protein: (0.0063); KEGG: rsp:RSP_1425 plasmid replication initiation protein, ev=1e-153, 64% identity TM1040:3.628..3.63 Mbp (1.293 kbp) score=10
TM1040_3633 PFAM: molybdopterin biosynthesis MoaE: (5.7e-46); KEGG: sil:SPO3633 molybdopterin converting factor, subunit 2, ev=1e-53, 72% identity TM1040:3.891..3.891 Mbp (447 bp) score=10
TM1040_3648 TIGRFAM: sulfate permease: (3.5e-132); PFAM: Sulfate transporter/antisigma-factor antagonist STAS: (9.4e-17) sulphate transporter: (3e-85); KEGG: sil:SPO1956 sulfate permease, ev=0.0, 66% identity TM1040:3.904..3.906 Mbp (1.767 kbp) score=10
TM1040_3751 is involved in the formation of active molybdenum cofactor and the chelation of molybdenum TM1040:4.01..4.011 Mbp (1.26 kbp) score=10
mobA in Escherichia coli MobA links a guanosine 5'-phosphate to molydopterin to form molybdopterin guanine dinucleotide during molybdenum cofactor biosynthesis TM1040:4.012..4.013 Mbp (636 bp) score=10
TM1040_3782 PFAM: beta-Ig-H3/fasciclin: (2.9e-41); KEGG: mlo:mlr4813 similar to secreted protein MPB70 (and transforming growth factor-induced protein), ev=3e-56, 64% identity TM1040:4.053..4.054 Mbp (552 bp) score=10

- Tracks
- General
 
- Analysis
 
- Display Settings
Image Width
Highlight feature(s) (feature1 feature2...)
Track Name Table
Highlight regions (region1:start..end region2:start..end)
Key position
- Add your own tracks

For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.70