Parts: | Type: | CDS | Description: | identified by similarity to GB:AAN55061.1; match to protein family HMM PF04304 | Source: | Genbank | Position: | CP000031.2:4179..4532 (- strand) | Length: | 354 | Dbxref: | NCBI_GP:AAV93336.1 | IMG: | SPO0005: hypothetical protein | Note: | identified by similarity to GB:AAN55061.1; match to protein family HMM PF04304 | RefSeq: | SPO_RS00025: YbaN family protein
| gbkey: | CDS | load_id: | cds-AAV93336.1 | locus_tag: | SPO0005 | parent_id: | gene-SPO0005 | product: | hypothetical protein | protein_id: | AAV93336.1 | transl_table: | 11 | translation: | MQFIWAALGLVCVALALIGVALPLLPTVPFLLLAAFFFARSSERLHTWLVTHRLFGPMIL DWQQSGAIRPGAKKAATLSIAAVFGLSLVFAVPSHVLLIQAVVLSGVLIFIWTRPNG |
---|
| |
---|
|
---|