Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0005
Type: gene
Description:
Source: Genbank
Position: CP000031.2:4179..4532 (- strand)
Length: 354
gbkey: Gene
gene: SPO0005
gene_biotype: protein_coding
load_id: gene-SPO0005
locus_tag: SPO0005
Parts:
Type: CDS
Description: identified by similarity to GB:AAN55061.1; match to protein family HMM PF04304
Source: Genbank
Position: CP000031.2:4179..4532 (- strand)
Length: 354
Dbxref: NCBI_GP:AAV93336.1
IMG: SPO0005: hypothetical protein
Note: identified by similarity to GB:AAN55061.1; match to protein family HMM PF04304
RefSeq: SPO_RS00025: YbaN family protein
gbkey: CDS
gene: SPO0005
load_id: cds-AAV93336.1
locus_tag: SPO0005
parent_id: gene-SPO0005
product: hypothetical protein
protein_id: AAV93336.1
transl_table: 11
translation: MQFIWAALGLVCVALALIGVALPLLPTVPFLLLAAFFFARSSERLHTWLVTHRLFGPMIL DWQQSGAIRPGAKKAATLSIAAVFGLSLVFAVPSHVLLIQAVVLSGVLIFIWTRPNG
>SPO0005 class=Sequence position=CP000031.2:4179..4532 (- strand)
ATGCAGTTTA TCTGGGCAGC TCTTGGACTG GTCTGCGTTG CCCTCGCCCT GATTGGCGTT GCGCTGCCGC TGCTGCCGAC
CGTACCGTTC CTGCTGCTCG CCGCCTTTTT CTTTGCCCGG TCATCAGAGC GCCTGCACAC ATGGCTGGTG ACCCATCGCC
TGTTTGGCCC GATGATTCTG GATTGGCAGC AATCGGGTGC CATTCGGCCC GGCGCAAAAA AGGCGGCAAC CTTGTCGATT
GCCGCCGTGT TTGGCCTGTC ACTCGTTTTC GCAGTCCCCT CGCACGTCCT GCTGATTCAG GCCGTGGTGC TAAGCGGGGT
TCTGATCTTT ATCTGGACCC GCCCTAACGG CTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7