Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0005
Type: CDS
Description: identified by similarity to GB:AAN55061.1; match to protein family HMM PF04304; NCBI:hypothetical protein; IMG:hypothetical protein
Source: GenBank
Position: DSS3:4179..4532 (- strand)
Length: 354
Dbxref: GI:56694933
  GeneID:3196415
Note: identified by similarity to GB:AAN55061.1; match to protein family HMM PF04304
  NCBI:hypothetical protein
  IMG:hypothetical protein
codon_start: 1
load_id: SPO0005.p01
parent_id: SPO0005.t01
product: hypothetical protein
protein_id: REF_tigr:SPO0005
  YP_165278.1
transl_table: 11
translation: MQFIWAALGLVCVALALIGVALPLLPTVPFLLLAAFFFARSSERLHTWLVTHRLFGPMIL DWQQSGAIRPGAKKAATLSIAAVFGLSLVFAVPSHVLLIQAVVLSGVLIFIWTRPNG
>SPO0005 class=Sequence position=DSS3:4179..4532 (- strand)
ATGCAGTTTA TCTGGGCAGC TCTTGGACTG GTCTGCGTTG CCCTCGCCCT GATTGGCGTT GCGCTGCCGC TGCTGCCGAC
CGTACCGTTC CTGCTGCTCG CCGCCTTTTT CTTTGCCCGG TCATCAGAGC GCCTGCACAC ATGGCTGGTG ACCCATCGCC
TGTTTGGCCC GATGATTCTG GATTGGCAGC AATCGGGTGC CATTCGGCCC GGCGCAAAAA AGGCGGCAAC CTTGTCGATT
GCCGCCGTGT TTGGCCTGTC ACTCGTTTTC GCAGTCCCCT CGCACGTCCT GCTGATTCAG GCCGTGGTGC TAAGCGGGGT
TCTGATCTTT ATCTGGACCC GCCCTAACGG CTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7