Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0006
Type: CDS
Description: identified by match to protein family HMM PF04055; match to protein family HMM PF06969; match to protein family HMM TIGR00539
Source: Genbank
Position: CP000031.2:4536..5693 (- strand)
Length: 1158
"ID: cds-AAV93337.1
Dbxref: NCBI_GP:AAV93337.1
IMG: SPO0006: coproporphyrinogen III oxidase
Note: identified by match to protein family HMM PF04055; match to protein family HMM PF06969; match to protein family HMM TIGR00539
RefSeq: SPO_RS00030: coproporphyrinogen III oxidase"
gbkey: CDS
gene: SPO0006
locus_tag: SPO0006
parent_id: gene-SPO0006
product: oxygen-independent coproporphyrinogen III oxidase
  putative
protein_id: AAV93337.1
transl_table: 11
translation: MADDWQHGGFGLYVHWPFCQAKCPYCDFNSHVAREIDQKAWVRAYVSELERCAAELPGRV LNTIFFGGGTPSLMMPETVAAVIETVRRLWPTSNDMEITLEANPGSVEAGRFAAYRDGGV NRISMGVQALNDRDLHRLGRIHSVAEARAAFDIARRCFERVSFDLIYARQDQTPEAWRAE LNEALAMAVDHLSLYQLTIEDGTAFGDRYARGKLRGLPADDDAADMYLITQEVCATHGLP AYEVSNHARPGSESRHNLIYWRYGDYVGIGPGAHGRITVDGQRFATESPLNPGAWLGAVA KGSGELSRVALSLQDQADEYLMMGLRIAEGLDIHRYEALSPQPLNRNRLAHLTELGMIEI EGTRLKATAQGRAVLNAVILDLMSE
>SPO0006 class=Sequence position=CP000031.2:4536..5693 (- strand)
TTGGCGGATG ACTGGCAGCA TGGGGGCTTT GGCCTCTACG TGCATTGGCC CTTTTGCCAG GCCAAGTGTC CCTATTGCGA
CTTCAACAGC CATGTTGCCC GTGAAATCGA CCAGAAAGCC TGGGTTAGAG CCTATGTTTC CGAACTTGAA CGCTGTGCCG
CTGAGCTGCC GGGCCGGGTT CTGAACACCA TCTTTTTTGG CGGCGGTACC CCGTCGCTGA TGATGCCGGA AACGGTCGCG
GCAGTGATCG AAACCGTCCG CCGTCTCTGG CCCACCTCCA ACGACATGGA AATCACGCTC GAGGCCAATC CCGGCTCGGT
TGAGGCCGGG CGCTTTGCCG CCTATCGCGA TGGCGGGGTC AACCGGATCT CGATGGGGGT GCAGGCGCTG AACGACCGGG
ACCTGCACCG GCTGGGCCGC ATCCACAGCG TGGCCGAGGC GCGGGCAGCT TTCGACATTG CGCGGCGCTG TTTTGAGCGG
GTCAGTTTCG ACCTGATCTA TGCCCGGCAG GACCAGACAC CCGAAGCGTG GCGTGCCGAG TTGAACGAGG CGCTGGCCAT
GGCGGTCGAT CACCTGTCGC TCTACCAGTT GACGATCGAG GACGGCACCG CCTTTGGCGA CCGCTATGCC CGCGGCAAGC
TGCGCGGCCT ACCCGCCGAT GACGACGCCG CCGACATGTA CCTGATCACG CAAGAGGTCT GCGCCACGCA TGGCCTGCCC
GCCTACGAGG TCTCGAACCA CGCCCGCCCC GGTTCGGAAT CGCGCCACAA CCTGATCTAT TGGCGCTATG GCGATTATGT
CGGCATCGGC CCCGGCGCAC ATGGTCGCAT CACCGTGGAT GGCCAGCGTT TCGCCACCGA AAGCCCGCTG AACCCTGGCG
CCTGGCTGGG CGCAGTGGCA AAGGGAAGTG GTGAGTTGAG CCGAGTAGCC CTCTCGCTAC AAGATCAAGC CGACGAATAC
CTGATGATGG GGCTTCGTAT TGCCGAAGGA CTAGATATCC ACCGATACGA GGCGCTTTCG CCGCAGCCCC TAAACCGGAA
CCGCCTTGCC CATTTGACCG AACTGGGCAT GATCGAGATC GAAGGTACGC GGCTGAAGGC CACCGCCCAG GGGCGTGCGG
TGCTGAACGC GGTCATTCTG GACCTGATGT CGGAGTAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7