Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0007
Type: gene
Description:
Source: Genbank
Position: CP000031.2:5683..6297 (- strand)
Length: 615
gbkey: Gene
gene: SPO0007
gene_biotype: protein_coding
load_id: gene-SPO0007
locus_tag: SPO0007
Parts:
Type: CDS
Description: identified by match to protein family HMM PF01725; match to protein family HMM TIGR00042
Source: Genbank
Position: CP000031.2:5683..6297 (- strand)
Length: 615
"ID: cds-AAV93338.1
Dbxref: NCBI_GP:AAV93338.1
IMG: SPO0007: dITPase (EC 3.6.1.-)
Note: identified by match to protein family HMM PF01725; match to protein family HMM TIGR00042
RefSeq: SPO_RS00035: rdgB: RdgB/HAM1 family non-canonical purine NTP pyrophosphatase"
gbkey: CDS
gene: SPO0007
locus_tag: SPO0007
parent_id: gene-SPO0007
product: non-canonical purine NTP pyrophosphatase
  rdgB/HAM1 family
protein_id: AAV93338.1
transl_table: 11
translation: MTRAFDGDTLLIATHNKGKLEEMAHLLQPFGVKVVGAAEMNLPEPEETEDTFVGNARIKA HAAARATGLPALSDDSGITIDALDGAPGVYTADWAETGNGRDFLMAMTRAHDALEAKSAP HPRLAQFRCTLVLAWPDGHDEVFEGVAPGHLVWPIRGAAGFGYDPMFVPEGYDVTFAEMD RWEKNKISHRARAVEKFVKGCFGG
>SPO0007 class=Sequence position=CP000031.2:5683..6297 (- strand)
ATGACACGGG CGTTCGACGG CGACACACTG CTGATCGCGA CCCACAACAA GGGCAAGCTG GAAGAGATGG CACATCTCCT
CCAGCCCTTT GGGGTCAAGG TTGTTGGCGC CGCCGAAATG AACCTGCCCG AACCGGAAGA GACCGAAGAC ACCTTTGTCG
GCAATGCCCG GATCAAGGCG CACGCCGCGG CCCGGGCCAC CGGCCTGCCC GCCCTGTCCG ATGACAGCGG CATCACCATC
GACGCGCTGG ATGGCGCGCC GGGCGTCTAT ACCGCCGACT GGGCCGAGAC CGGCAATGGG CGCGATTTCC TGATGGCGAT
GACCCGCGCC CATGACGCGC TGGAAGCCAA AAGCGCCCCG CATCCCCGGC TGGCGCAATT CCGCTGCACG CTGGTTCTGG
CCTGGCCCGA TGGCCATGAC GAGGTGTTCG AAGGCGTCGC CCCCGGCCAT CTGGTCTGGC CCATTCGTGG CGCCGCAGGC
TTCGGTTATG ATCCGATGTT CGTGCCCGAA GGGTATGACG TGACCTTTGC GGAAATGGAT CGCTGGGAAA AGAACAAGAT
CAGCCACCGC GCACGGGCGG TGGAGAAATT CGTGAAGGGC TGTTTTGGCG GATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7