Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0007
Type: gene
Description:
Source: GenBank
Position: DSS3:5683..6297 (- strand)
Length: 615
Dbxref: GeneID:3196546
load_id: SPO0007
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:5683..6297 (- strand)
Length: 615
load_id: SPO0007.t01
parent_id: SPO0007
Parts:
Type: CDS
Description: identified by match to protein family HMM PF01725; match to protein family HMM TIGR00042; NCBI:non-canonical purine NTP pyrophosphatase; IMG:dITPase (EC 3.6.1.-)
Source: GenBank
Position: DSS3:5683..6297 (- strand)
Length: 615
Dbxref: GI:56694935
  GeneID:3196546
Note: identified by match to protein family HMM PF01725; match to protein family HMM TIGR00042
  NCBI:non-canonical purine NTP pyrophosphatase
  IMG:dITPase (EC 3.6.1.-)
codon_start: 1
load_id: SPO0007.p01
parent_id: SPO0007.t01
product: non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
protein_id: REF_tigr:SPO0007
  YP_165280.1
transl_table: 11
translation: MTRAFDGDTLLIATHNKGKLEEMAHLLQPFGVKVVGAAEMNLPEPEETEDTFVGNARIKA HAAARATGLPALSDDSGITIDALDGAPGVYTADWAETGNGRDFLMAMTRAHDALEAKSAP HPRLAQFRCTLVLAWPDGHDEVFEGVAPGHLVWPIRGAAGFGYDPMFVPEGYDVTFAEMD RWEKNKISHRARAVEKFVKGCFGG
Type: exon
Description:
Source: GenBank
Position: DSS3:5683..6297 (- strand)
Length: 615
parent_id: SPO0007.t01
> class=Sequence position=DSS3:5683..6297 (- strand)
ATGACACGGG CGTTCGACGG CGACACACTG CTGATCGCGA CCCACAACAA GGGCAAGCTG GAAGAGATGG CACATCTCCT
CCAGCCCTTT GGGGTCAAGG TTGTTGGCGC CGCCGAAATG AACCTGCCCG AACCGGAAGA GACCGAAGAC ACCTTTGTCG
GCAATGCCCG GATCAAGGCG CACGCCGCGG CCCGGGCCAC CGGCCTGCCC GCCCTGTCCG ATGACAGCGG CATCACCATC
GACGCGCTGG ATGGCGCGCC GGGCGTCTAT ACCGCCGACT GGGCCGAGAC CGGCAATGGG CGCGATTTCC TGATGGCGAT
GACCCGCGCC CATGACGCGC TGGAAGCCAA AAGCGCCCCG CATCCCCGGC TGGCGCAATT CCGCTGCACG CTGGTTCTGG
CCTGGCCCGA TGGCCATGAC GAGGTGTTCG AAGGCGTCGC CCCCGGCCAT CTGGTCTGGC CCATTCGTGG CGCCGCAGGC
TTCGGTTATG ATCCGATGTT CGTGCCCGAA GGGTATGACG TGACCTTTGC GGAAATGGAT CGCTGGGAAA AGAACAAGAT
CAGCCACCGC GCACGGGCGG TGGAGAAATT CGTGAAGGGC TGTTTTGGCG GATGA
>SPO0007 class=Sequence position=DSS3:5683..6297 (- strand)
ATGACACGGG CGTTCGACGG CGACACACTG CTGATCGCGA CCCACAACAA GGGCAAGCTG GAAGAGATGG CACATCTCCT
CCAGCCCTTT GGGGTCAAGG TTGTTGGCGC CGCCGAAATG AACCTGCCCG AACCGGAAGA GACCGAAGAC ACCTTTGTCG
GCAATGCCCG GATCAAGGCG CACGCCGCGG CCCGGGCCAC CGGCCTGCCC GCCCTGTCCG ATGACAGCGG CATCACCATC
GACGCGCTGG ATGGCGCGCC GGGCGTCTAT ACCGCCGACT GGGCCGAGAC CGGCAATGGG CGCGATTTCC TGATGGCGAT
GACCCGCGCC CATGACGCGC TGGAAGCCAA AAGCGCCCCG CATCCCCGGC TGGCGCAATT CCGCTGCACG CTGGTTCTGG
CCTGGCCCGA TGGCCATGAC GAGGTGTTCG AAGGCGTCGC CCCCGGCCAT CTGGTCTGGC CCATTCGTGG CGCCGCAGGC
TTCGGTTATG ATCCGATGTT CGTGCCCGAA GGGTATGACG TGACCTTTGC GGAAATGGAT CGCTGGGAAA AGAACAAGAT
CAGCCACCGC GCACGGGCGG TGGAGAAATT CGTGAAGGGC TGTTTTGGCG GATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7