Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0015
Type: CDS
Description:
Source: Genbank
Position: CP000031.2:15491..16264 (+ strand)
Length: 774
Dbxref: NCBI_GP:AAV93346.1
IMG:
RefSeq: SPO_RS00075: hypothetical protein
gbkey: CDS
gene: SPO0015
load_id: cds-AAV93346.1
locus_tag: SPO0015
parent_id: gene-SPO0015
product: hypothetical protein
protein_id: AAV93346.1
transl_table: 11
translation: MEPAGQGVSVRPKPAIGEQNMKIAMWSGPRNLSTAMMYAFGARTDCAVIDEPFYAAYLAM TGLHHPMREEVLAAQSQDPGQVAAMLSGPNPGARPFWYQKHMTQHMIPGIPRDWMRSVCN VFLIRHPARVIASYAEKRENPTLEDIGFRQQAELFDEVSGWGGDPLVIDSHDIREDPARM LERLCDRIGVPWSPHMLSWPKGGHKDDGVWARHWYGAVWNSTGFAGPEGDLPEVPEALQP VLQAAMPFYERMRAVKI
>SPO0015 class=Sequence position=CP000031.2:15491..16264 (+ strand)
TTGGAACCGG CCGGGCAGGG CGTTAGCGTG CGGCCAAAAC CGGCAATCGG AGAGCAGAAC ATGAAAATCG CCATGTGGTC
GGGGCCGCGC AATCTGTCGA CGGCGATGAT GTACGCCTTT GGCGCCCGGA CCGATTGCGC GGTGATCGAC GAGCCGTTCT
ATGCCGCCTA TCTGGCGATG ACCGGACTGC ATCATCCGAT GCGCGAAGAG GTTCTGGCCG CCCAGTCGCA AGACCCAGGT
CAGGTGGCGG CAATGCTAAG CGGGCCCAAT CCCGGGGCGC GGCCGTTCTG GTATCAGAAG CACATGACGC AGCACATGAT
CCCCGGCATC CCGCGCGACT GGATGCGGTC GGTCTGCAAC GTGTTCCTGA TCCGCCATCC GGCGCGGGTG ATCGCCAGCT
ATGCCGAAAA GCGCGAGAAC CCGACGCTGG AAGATATCGG TTTTCGTCAG CAGGCGGAAC TTTTTGACGA GGTGTCTGGC
TGGGGCGGCG ACCCATTGGT CATCGACAGC CACGATATCC GCGAAGATCC GGCGCGGATG CTGGAACGGC TCTGCGACCG
GATTGGCGTC CCGTGGTCGC CGCATATGCT GAGTTGGCCC AAGGGCGGCC ACAAGGATGA TGGAGTCTGG GCGCGGCACT
GGTACGGGGC GGTCTGGAAC TCGACCGGAT TCGCAGGGCC CGAAGGCGAT TTGCCCGAGG TTCCAGAGGC GTTGCAGCCG
GTCTTGCAAG CCGCGATGCC ATTTTATGAG CGCATGCGCG CCGTCAAGAT TTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7