Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0016
Type: CDS
Description: identified by match to protein family HMM PF02036
Source: Genbank
Position: CP000031.2:16332..16613 (- strand)
Length: 282
Dbxref: NCBI_GP:AAV93347.1
IMG: SPO0016: sterol carrier family protein
Note: identified by match to protein family HMM PF02036
RefSeq: SPO_RS00080: SCP2 sterol-binding domain-containing protein
gbkey: CDS
gene: SPO0016
load_id: cds-AAV93347.1
locus_tag: SPO0016
parent_id: gene-SPO0016
product: sterol carrier family protein
protein_id: AAV93347.1
transl_table: 11
translation: MLQDIADKMQTELAGKSFDGSLKFDCGDDGVIVLADNTASTQDRDTDCTIRLSQDNLVKL LTGKLNPMTGVMMGKLKISGNMGVAMKLGQLLG
>SPO0016 class=Sequence position=CP000031.2:16332..16613 (- strand)
ATGCTTCAGG ATATCGCCGA CAAGATGCAG ACCGAACTGG CGGGCAAAAG CTTTGACGGG TCGCTGAAAT TCGACTGTGG
CGACGATGGT GTGATCGTTC TGGCTGACAA CACCGCCAGC ACCCAGGACC GCGACACCGA CTGCACCATC CGCCTGAGCC
AGGACAATCT GGTCAAGCTG CTGACCGGCA AGCTGAACCC GATGACCGGC GTGATGATGG GCAAGCTCAA GATCAGCGGC
AACATGGGTG TGGCGATGAA GCTGGGGCAA TTGCTGGGCT AG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7