Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0016
Type: CDS
Description: identified by match to protein family HMM PF02036; NCBI:sterol carrier protein; IMG:Putative sterol carrier protein
Source: GenBank
Position: DSS3:16332..16613 (- strand)
Length: 282
Dbxref: GI:56694944
  GeneID:3194043
Note: identified by match to protein family HMM PF02036
  NCBI:sterol carrier protein
  IMG:Putative sterol carrier protein
codon_start: 1
load_id: SPO0016.p01
parent_id: SPO0016.t01
product: sterol carrier family protein
protein_id: REF_tigr:SPO0016
  YP_165289.1
transl_table: 11
translation: MLQDIADKMQTELAGKSFDGSLKFDCGDDGVIVLADNTASTQDRDTDCTIRLSQDNLVKL LTGKLNPMTGVMMGKLKISGNMGVAMKLGQLLG
>SPO0016 class=Sequence position=DSS3:16332..16613 (- strand)
ATGCTTCAGG ATATCGCCGA CAAGATGCAG ACCGAACTGG CGGGCAAAAG CTTTGACGGG TCGCTGAAAT TCGACTGTGG
CGACGATGGT GTGATCGTTC TGGCTGACAA CACCGCCAGC ACCCAGGACC GCGACACCGA CTGCACCATC CGCCTGAGCC
AGGACAATCT GGTCAAGCTG CTGACCGGCA AGCTGAACCC GATGACCGGC GTGATGATGG GCAAGCTCAA GATCAGCGGC
AACATGGGTG TGGCGATGAA GCTGGGGCAA TTGCTGGGCT AG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7