Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0017
Type: CDS
Description: identified by similarity to GB:BAC49462.1
Source: Genbank
Position: CP000031.2:16689..17132 (- strand)
Length: 444
Dbxref: NCBI_GP:AAV93348.1
IMG: SPO0017: hypothetical protein
Note: identified by similarity to GB:BAC49462.1
RefSeq: SPO_RS00085: DUF1810 domain-containing protein
gbkey: CDS
gene: SPO0017
load_id: cds-AAV93348.1
locus_tag: SPO0017
parent_id: gene-SPO0017
product: hypothetical protein
protein_id: AAV93348.1
transl_table: 11
translation: MIGEDEFDDDDELEMFVEAQDTVWPDVLRELTLGQKTSHWMWFVFPQLAELGQSHMAQLY GIGDLDEAAAYLAHPALRARLIEVSRLMLTHAGKRPDDILGSIDAKKLRSSMTLFAAVPD APGEFRAVLEAFYDGSPCPLTLRALGG
>SPO0017 class=Sequence position=CP000031.2:16689..17132 (- strand)
GTGATCGGCG AAGACGAGTT TGACGATGAT GACGAACTGG AGATGTTCGT CGAGGCGCAG GACACCGTCT GGCCGGATGT
CCTGCGCGAA CTAACTTTGG GGCAAAAGAC GAGCCACTGG ATGTGGTTCG TCTTTCCGCA GCTGGCCGAA CTCGGCCAGT
CGCATATGGC GCAGCTTTAC GGGATCGGGG ATCTGGACGA GGCGGCCGCC TATCTGGCCC ATCCCGCATT GCGCGCCCGA
CTGATCGAGG TCAGCCGCCT GATGTTGACC CATGCCGGTA AACGGCCCGA CGATATCCTT GGCAGCATCG ACGCCAAGAA
GCTGCGTTCT TCCATGACGC TGTTCGCCGC GGTGCCGGAT GCGCCGGGTG AATTCCGCGC GGTTCTGGAG GCGTTCTATG
ACGGATCGCC CTGCCCCCTG ACCCTGCGCG CGCTGGGCGG CTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7