Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0017
Type: gene
Description:
Source: GenBank
Position: DSS3:16689..17132 (- strand)
Length: 444
Dbxref: GeneID:3194316
load_id: SPO0017
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:16689..17132 (- strand)
Length: 444
load_id: SPO0017.t01
parent_id: SPO0017
Parts:
Type: CDS
Description: identified by similarity to GB:BAC49462.1; NCBI:calpastatin; IMG:Uncharacterized protein; DUF1810 family
Source: GenBank
Position: DSS3:16689..17132 (- strand)
Length: 444
Dbxref: GI:56694945
  GeneID:3194316
Note: identified by similarity to GB:BAC49462.1
  NCBI:calpastatin
  IMG:Uncharacterized protein
  DUF1810 family
codon_start: 1
load_id: SPO0017.p01
parent_id: SPO0017.t01
product: hypothetical protein
protein_id: REF_tigr:SPO0017
  YP_165290.1
transl_table: 11
translation: MIGEDEFDDDDELEMFVEAQDTVWPDVLRELTLGQKTSHWMWFVFPQLAELGQSHMAQLY GIGDLDEAAAYLAHPALRARLIEVSRLMLTHAGKRPDDILGSIDAKKLRSSMTLFAAVPD APGEFRAVLEAFYDGSPCPLTLRALGG
Type: exon
Description:
Source: GenBank
Position: DSS3:16689..17132 (- strand)
Length: 444
parent_id: SPO0017.t01
> class=Sequence position=DSS3:16689..17132 (- strand)
GTGATCGGCG AAGACGAGTT TGACGATGAT GACGAACTGG AGATGTTCGT CGAGGCGCAG GACACCGTCT GGCCGGATGT
CCTGCGCGAA CTAACTTTGG GGCAAAAGAC GAGCCACTGG ATGTGGTTCG TCTTTCCGCA GCTGGCCGAA CTCGGCCAGT
CGCATATGGC GCAGCTTTAC GGGATCGGGG ATCTGGACGA GGCGGCCGCC TATCTGGCCC ATCCCGCATT GCGCGCCCGA
CTGATCGAGG TCAGCCGCCT GATGTTGACC CATGCCGGTA AACGGCCCGA CGATATCCTT GGCAGCATCG ACGCCAAGAA
GCTGCGTTCT TCCATGACGC TGTTCGCCGC GGTGCCGGAT GCGCCGGGTG AATTCCGCGC GGTTCTGGAG GCGTTCTATG
ACGGATCGCC CTGCCCCCTG ACCCTGCGCG CGCTGGGCGG CTGA
>SPO0017 class=Sequence position=DSS3:16689..17132 (- strand)
GTGATCGGCG AAGACGAGTT TGACGATGAT GACGAACTGG AGATGTTCGT CGAGGCGCAG GACACCGTCT GGCCGGATGT
CCTGCGCGAA CTAACTTTGG GGCAAAAGAC GAGCCACTGG ATGTGGTTCG TCTTTCCGCA GCTGGCCGAA CTCGGCCAGT
CGCATATGGC GCAGCTTTAC GGGATCGGGG ATCTGGACGA GGCGGCCGCC TATCTGGCCC ATCCCGCATT GCGCGCCCGA
CTGATCGAGG TCAGCCGCCT GATGTTGACC CATGCCGGTA AACGGCCCGA CGATATCCTT GGCAGCATCG ACGCCAAGAA
GCTGCGTTCT TCCATGACGC TGTTCGCCGC GGTGCCGGAT GCGCCGGGTG AATTCCGCGC GGTTCTGGAG GCGTTCTATG
ACGGATCGCC CTGCCCCCTG ACCCTGCGCG CGCTGGGCGG CTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7