Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0019
Type: gene
Description:
Source: Genbank
Position: CP000031.2:18450..19280 (+ strand)
Length: 831
gbkey: Gene
gene: SPO0019
gene_biotype: protein_coding
load_id: gene-SPO0019
locus_tag: SPO0019
Parts:
Type: CDS
Description:
Source: Genbank
Position: CP000031.2:18450..19280 (+ strand)
Length: 831
Dbxref: NCBI_GP:AAV93350.1
IMG:
RefSeq: SPO_RS00095: hypothetical protein
gbkey: CDS
gene: SPO0019
load_id: cds-AAV93350.1
locus_tag: SPO0019
parent_id: gene-SPO0019
product: hypothetical protein
protein_id: AAV93350.1
transl_table: 11
translation: MKQQSATQVMVEGCFKMLGWRIFLYSIRMVLRNWRHALRLALVPAILGSVAMMTIAWVMQ SGPAFEQFFGAGLNDLDKTEMTRQHTLSSLLVLVPQAVASLWIVITWHRFILLEEAQDGW VPPLRPGRTLAYFALSVGIVLIFAAVAFPVVYATVVLAAALGLRGMAVALTLAVLLLLSP LSQRALLVLPASAIGQPLSFGDALTLTRDHYWTMLIVAVSGSAMQHGLSTVLSFVGGTST VGPVAALFLTLLLQPLLWASVLTTLYGVFVEKRPLG
>SPO0019 class=Sequence position=CP000031.2:18450..19280 (+ strand)
ATGAAACAAC AGAGTGCCAC ACAAGTTATG GTTGAGGGGT GTTTCAAAAT GTTAGGTTGG CGGATTTTCC TGTATTCGAT
CCGGATGGTT CTGCGCAATT GGCGACACGC TCTGCGGCTG GCCCTTGTGC CCGCGATCCT TGGCAGCGTG GCGATGATGA
CAATAGCCTG GGTCATGCAA AGCGGCCCTG CGTTTGAACA ATTTTTCGGG GCAGGGCTCA ACGATCTCGA CAAGACCGAG
ATGACCCGCC AGCATACGCT TTCCTCGCTG TTGGTCCTTG TGCCTCAAGC TGTAGCCAGC CTCTGGATCG TGATAACTTG
GCATCGGTTC ATTCTGCTGG AAGAAGCGCA GGACGGCTGG GTGCCGCCCT TGCGTCCGGG GCGAACCCTC GCCTATTTCG
CCCTGTCGGT GGGGATCGTG TTGATCTTTG CGGCTGTCGC GTTTCCTGTT GTCTATGCGA CGGTCGTTCT TGCTGCTGCG
TTGGGGCTGC GTGGCATGGC GGTTGCGCTC ACGTTAGCGG TATTGCTGCT TCTGTCGCCC TTGTCGCAAA GGGCACTACT
TGTCCTGCCT GCCTCTGCCA TCGGCCAACC GCTGAGTTTC GGTGACGCGC TGACGCTGAC ACGCGATCAC TACTGGACCA
TGCTGATTGT CGCGGTATCG GGGTCTGCCA TGCAACATGG GCTTTCGACC GTGCTGTCTT TCGTAGGCGG AACCTCTACC
GTTGGGCCGG TCGCCGCGCT TTTCCTGACG CTGTTGTTGC AACCGCTGCT CTGGGCGAGT GTTCTGACCA CTCTCTACGG
GGTCTTTGTG GAGAAGCGCC CGCTTGGCTG A

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7