Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0021
Type: CDS
Description: identified by match to protein family HMM PF01627; NCBI:histidine kinase; IMG:Hpt domain-containing protein
Source: GenBank
Position: DSS3:20571..20924 (- strand)
Length: 354
Dbxref: GI:56694949
  GeneID:3196142
Note: identified by match to protein family HMM PF01627
  NCBI:histidine kinase
  IMG:Hpt domain-containing protein
codon_start: 1
load_id: SPO0021.p01
parent_id: SPO0021.t01
product: Hpt domain protein
protein_id: REF_tigr:SPO0021
  YP_165294.1
transl_table: 11
translation: MGQRERRCAMIHWPRVTQLREEVGAEDFEEVVDLFLEEVEEVITRLRQAPDRSLLEKDLH FLKGSALSLGFQSFSALCQDGERQSAAGHADTVDLDAIINSFEASKSVFQSELPGHI
>SPO0021 class=Sequence position=DSS3:20571..20924 (- strand)
ATGGGGCAGA GAGAACGGAG GTGCGCCATG ATTCACTGGC CCCGCGTGAC CCAATTGCGG GAAGAGGTCG GTGCGGAGGA
TTTCGAAGAG GTTGTGGACC TGTTCCTGGA AGAGGTCGAA GAGGTGATCA CGCGTCTTCG GCAGGCACCG GATCGCAGCC
TGCTTGAAAA GGATCTGCAT TTTCTCAAGG GCAGCGCGCT CAGCCTTGGG TTTCAGTCCT TTTCCGCCCT GTGCCAGGAT
GGCGAGCGGC AATCGGCCGC CGGTCATGCG GACACGGTCG ACCTGGATGC CATCATCAAC AGTTTCGAGG CGTCGAAATC
GGTGTTCCAA TCGGAACTGC CCGGTCATAT CTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7