Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0022
Type: gene
Description:
Source: GenBank
Position: DSS3:21005..22342 (+ strand)
Length: 1338
Dbxref: GeneID:3194721
load_id: SPO0022
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:21005..22342 (+ strand)
Length: 1338
load_id: SPO0022.t01
parent_id: SPO0022
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00072; match to protein family HMM PF07228; NCBI:chemotaxis protein CheY; IMG:Response regulator receiver domain-containing protein
Source: GenBank
Position: DSS3:21005..22342 (+ strand)
Length: 1338
Dbxref: GI:56694950
  GeneID:3194721
Note: identified by match to protein family HMM PF00072; match to protein family HMM PF07228
  NCBI:chemotaxis protein CheY
  IMG:Response regulator receiver domain-containing protein
codon_start: 1
load_id: SPO0022.p01
parent_id: SPO0022.t01
product: response regulator
protein_id: REF_tigr:SPO0022
  YP_165295.1
transl_table: 11
translation: MLTGTCLAWAVSLALVKSGQTTVLHGREMEAQTDMEPGAIRRVLVVDDSRLQRRILSSSL KKWGFEVIEAESGEEAMEICARAMPDLVLSDWVMPGMSGVDFCEAFRQLNSDRYCYFILL TSKSEKNEVAQGLDAGADDFLIKPVSSDELRARISAGDRVIGMQRELSAKNEVIEQALDD LKRAHDAIDKDLIQARKIQESLVPDFSQDFGSSRISLLLKPCGHIGGDLVGMFSPGPNRV GFYSIDVSGHGITSAMMTARLGGYLSSRYFDQNVAMEKRFNKFFALRQPQDVAETLNSRL IADTGIEEYFTMVYAIMDLRSGMLRMVQAGHPHPLLLRRDGTAEFIGEGGVPIGLLPGVP FTQVEVQMEVGDRLLLYSDGFTECRLANGEMLEPEGLLALVNECNPEQGGQEFLDDLFWR LTQVMSPEHGLEDDVSATFFEFNGP
Type: exon
Description:
Source: GenBank
Position: DSS3:21005..22342 (+ strand)
Length: 1338
parent_id: SPO0022.t01
> class=Sequence position=DSS3:21005..22342 (+ strand)
ATGTTAACGG GGACCTGCCT AGCGTGGGCC GTATCCTTGG CCTTGGTGAA ATCGGGACAG ACAACAGTGT TGCATGGTAG
GGAAATGGAG GCCCAGACCG ATATGGAACC GGGCGCAATC CGCCGGGTGC TGGTTGTTGA CGACAGCCGG TTGCAGCGCC
GCATCCTGTC GAGCTCGCTG AAGAAATGGG GATTCGAGGT GATCGAGGCC GAAAGCGGCG AGGAGGCGAT GGAAATCTGC
GCTCGCGCCA TGCCCGATCT GGTGTTGAGC GACTGGGTCA TGCCGGGGAT GAGCGGCGTC GATTTCTGCG AGGCGTTCCG
GCAACTGAAT TCTGACCGAT ACTGCTATTT CATCCTGCTT ACATCGAAGA GCGAAAAGAA CGAGGTGGCG CAGGGGCTGG
ATGCCGGGGC CGACGATTTC CTGATCAAGC CGGTCAGCTC GGACGAGCTG CGGGCGCGGA TTTCGGCCGG GGACCGCGTG
ATCGGCATGC AGCGAGAGCT TTCGGCCAAG AACGAAGTGA TCGAACAGGC GCTGGACGAT CTGAAACGCG CCCATGACGC
CATCGACAAG GACTTGATCC AGGCGCGCAA GATTCAGGAA TCGCTGGTGC CCGACTTCAG CCAGGATTTC GGTTCCTCGC
GGATCAGCCT GCTGCTGAAA CCCTGTGGGC ATATCGGCGG CGATCTGGTG GGCATGTTCT CACCCGGGCC GAACCGGGTC
GGGTTCTACA GCATCGACGT TTCAGGCCAT GGCATCACCT CGGCGATGAT GACCGCGCGT CTGGGTGGCT ATCTGTCCAG
CCGCTATTTC GACCAGAATG TCGCGATGGA GAAGCGGTTC AACAAGTTTT TCGCCCTGCG CCAGCCGCAA GACGTGGCCG
AGACCCTCAA CTCCCGCCTG ATCGCCGATA CCGGGATCGA GGAATATTTC ACCATGGTCT ACGCGATCAT GGACCTGCGC
AGCGGCATGT TGCGGATGGT GCAGGCCGGA CACCCGCACC CGCTGCTCTT GCGTCGGGAC GGTACGGCGG AATTCATCGG
TGAGGGTGGC GTTCCCATCG GTCTGTTGCC GGGCGTTCCC TTTACCCAGG TCGAGGTGCA GATGGAGGTT GGTGACCGGC
TTCTGCTTTA CTCCGACGGG TTTACCGAAT GCCGCCTTGC CAATGGCGAG ATGCTGGAGC CAGAGGGGCT ACTGGCGCTG
GTCAATGAGT GTAATCCCGA ACAGGGCGGT CAGGAGTTTC TGGATGACTT GTTCTGGCGC CTGACTCAGG TCATGTCGCC
TGAACACGGG CTTGAGGATG ATGTGTCGGC AACGTTTTTC GAGTTTAACG GGCCGTGA
>SPO0022 class=Sequence position=DSS3:21005..22342 (+ strand)
ATGTTAACGG GGACCTGCCT AGCGTGGGCC GTATCCTTGG CCTTGGTGAA ATCGGGACAG ACAACAGTGT TGCATGGTAG
GGAAATGGAG GCCCAGACCG ATATGGAACC GGGCGCAATC CGCCGGGTGC TGGTTGTTGA CGACAGCCGG TTGCAGCGCC
GCATCCTGTC GAGCTCGCTG AAGAAATGGG GATTCGAGGT GATCGAGGCC GAAAGCGGCG AGGAGGCGAT GGAAATCTGC
GCTCGCGCCA TGCCCGATCT GGTGTTGAGC GACTGGGTCA TGCCGGGGAT GAGCGGCGTC GATTTCTGCG AGGCGTTCCG
GCAACTGAAT TCTGACCGAT ACTGCTATTT CATCCTGCTT ACATCGAAGA GCGAAAAGAA CGAGGTGGCG CAGGGGCTGG
ATGCCGGGGC CGACGATTTC CTGATCAAGC CGGTCAGCTC GGACGAGCTG CGGGCGCGGA TTTCGGCCGG GGACCGCGTG
ATCGGCATGC AGCGAGAGCT TTCGGCCAAG AACGAAGTGA TCGAACAGGC GCTGGACGAT CTGAAACGCG CCCATGACGC
CATCGACAAG GACTTGATCC AGGCGCGCAA GATTCAGGAA TCGCTGGTGC CCGACTTCAG CCAGGATTTC GGTTCCTCGC
GGATCAGCCT GCTGCTGAAA CCCTGTGGGC ATATCGGCGG CGATCTGGTG GGCATGTTCT CACCCGGGCC GAACCGGGTC
GGGTTCTACA GCATCGACGT TTCAGGCCAT GGCATCACCT CGGCGATGAT GACCGCGCGT CTGGGTGGCT ATCTGTCCAG
CCGCTATTTC GACCAGAATG TCGCGATGGA GAAGCGGTTC AACAAGTTTT TCGCCCTGCG CCAGCCGCAA GACGTGGCCG
AGACCCTCAA CTCCCGCCTG ATCGCCGATA CCGGGATCGA GGAATATTTC ACCATGGTCT ACGCGATCAT GGACCTGCGC
AGCGGCATGT TGCGGATGGT GCAGGCCGGA CACCCGCACC CGCTGCTCTT GCGTCGGGAC GGTACGGCGG AATTCATCGG
TGAGGGTGGC GTTCCCATCG GTCTGTTGCC GGGCGTTCCC TTTACCCAGG TCGAGGTGCA GATGGAGGTT GGTGACCGGC
TTCTGCTTTA CTCCGACGGG TTTACCGAAT GCCGCCTTGC CAATGGCGAG ATGCTGGAGC CAGAGGGGCT ACTGGCGCTG
GTCAATGAGT GTAATCCCGA ACAGGGCGGT CAGGAGTTTC TGGATGACTT GTTCTGGCGC CTGACTCAGG TCATGTCGCC
TGAACACGGG CTTGAGGATG ATGTGTCGGC AACGTTTTTC GAGTTTAACG GGCCGTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7