Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0023
Type: gene
Description:
Source: Genbank
Position: CP000031.2:22329..22781 (- strand)
Length: 453
gbkey: Gene
gene: SPO0023
gene_biotype: protein_coding
load_id: gene-SPO0023
locus_tag: SPO0023
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00293
Source: Genbank
Position: CP000031.2:22329..22781 (- strand)
Length: 453
"ID: cds-AAV93354.1
Dbxref: NCBI_GP:AAV93354.1
IMG:
Note: identified by match to protein family HMM PF00293
RefSeq: SPO_RS00115: NUDIX hydrolase"
gbkey: CDS
gene: SPO0023
locus_tag: SPO0023
parent_id: gene-SPO0023
product: hydrolase
  NUDIX family
protein_id: AAV93354.1
transl_table: 11
translation: MIRRFGESPEPGRRYTRRVGAYALLPRGSDLLLTSQYDPDPDLQLPGGGIDPGESPVAAL HREVYEETGWLIAAPRRIGAFRRFAYMPEYNLWAEKICLIYRARPVRRIGPPTEPDHAAL WMPAHSAAQLLGNAGDRHFAARHLARITAR
>SPO0023 class=Sequence position=CP000031.2:22329..22781 (- strand)
ATGATCAGAC GTTTTGGGGA AAGCCCCGAG CCGGGCCGCC GTTACACCCG CAGGGTCGGA GCCTATGCCC TGCTGCCGCG
AGGATCGGAT CTGCTGCTGA CCAGCCAGTA TGACCCCGAT CCCGACCTGC AACTGCCCGG TGGCGGCATC GATCCGGGCG
AATCGCCGGT CGCCGCGCTG CATCGCGAGG TTTACGAGGA AACCGGCTGG CTGATCGCCG CACCGCGCCG GATAGGGGCG
TTCCGCCGCT TTGCCTATAT GCCGGAATAC AATCTCTGGG CCGAAAAGAT CTGTCTGATC TACCGCGCCC GGCCGGTGCG
CCGTATCGGC CCGCCGACAG AACCCGATCA CGCCGCCCTG TGGATGCCGG CCCACAGCGC AGCGCAACTG CTGGGCAATG
CCGGCGACCG TCATTTCGCC GCCCGGCATC TGGCGCGGAT CACGGCCCGT TAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7