Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0023
Type: gene
Description:
Source: GenBank
Position: DSS3:22329..22781 (- strand)
Length: 453
Dbxref: GeneID:3194753
load_id: SPO0023
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:22329..22781 (- strand)
Length: 453
load_id: SPO0023.t01
parent_id: SPO0023
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00293; NCBI:NUDIX hydrolase; IMG:8-oxo-dGTP diphosphatase
Source: GenBank
Position: DSS3:22329..22781 (- strand)
Length: 453
Dbxref: GI:56694951
  GeneID:3194753
Note: identified by match to protein family HMM PF00293
  NCBI:NUDIX hydrolase
  IMG:8-oxo-dGTP diphosphatase
codon_start: 1
load_id: SPO0023.p01
parent_id: SPO0023.t01
product: hydrolase, NUDIX family
protein_id: REF_tigr:SPO0023
  YP_165296.1
transl_table: 11
translation: MIRRFGESPEPGRRYTRRVGAYALLPRGSDLLLTSQYDPDPDLQLPGGGIDPGESPVAAL HREVYEETGWLIAAPRRIGAFRRFAYMPEYNLWAEKICLIYRARPVRRIGPPTEPDHAAL WMPAHSAAQLLGNAGDRHFAARHLARITAR
Type: exon
Description:
Source: GenBank
Position: DSS3:22329..22781 (- strand)
Length: 453
parent_id: SPO0023.t01
> class=Sequence position=DSS3:22329..22781 (- strand)
ATGATCAGAC GTTTTGGGGA AAGCCCCGAG CCGGGCCGCC GTTACACCCG CAGGGTCGGA GCCTATGCCC TGCTGCCGCG
AGGATCGGAT CTGCTGCTGA CCAGCCAGTA TGACCCCGAT CCCGACCTGC AACTGCCCGG TGGCGGCATC GATCCGGGCG
AATCGCCGGT CGCCGCGCTG CATCGCGAGG TTTACGAGGA AACCGGCTGG CTGATCGCCG CACCGCGCCG GATAGGGGCG
TTCCGCCGCT TTGCCTATAT GCCGGAATAC AATCTCTGGG CCGAAAAGAT CTGTCTGATC TACCGCGCCC GGCCGGTGCG
CCGTATCGGC CCGCCGACAG AACCCGATCA CGCCGCCCTG TGGATGCCGG CCCACAGCGC AGCGCAACTG CTGGGCAATG
CCGGCGACCG TCATTTCGCC GCCCGGCATC TGGCGCGGAT CACGGCCCGT TAA
>SPO0023 class=Sequence position=DSS3:22329..22781 (- strand)
ATGATCAGAC GTTTTGGGGA AAGCCCCGAG CCGGGCCGCC GTTACACCCG CAGGGTCGGA GCCTATGCCC TGCTGCCGCG
AGGATCGGAT CTGCTGCTGA CCAGCCAGTA TGACCCCGAT CCCGACCTGC AACTGCCCGG TGGCGGCATC GATCCGGGCG
AATCGCCGGT CGCCGCGCTG CATCGCGAGG TTTACGAGGA AACCGGCTGG CTGATCGCCG CACCGCGCCG GATAGGGGCG
TTCCGCCGCT TTGCCTATAT GCCGGAATAC AATCTCTGGG CCGAAAAGAT CTGTCTGATC TACCGCGCCC GGCCGGTGCG
CCGTATCGGC CCGCCGACAG AACCCGATCA CGCCGCCCTG TGGATGCCGG CCCACAGCGC AGCGCAACTG CTGGGCAATG
CCGGCGACCG TCATTTCGCC GCCCGGCATC TGGCGCGGAT CACGGCCCGT TAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7