Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0025
Type: gene
Description:
Source: Genbank
Position: CP000031.2:23831..24427 (+ strand)
Length: 597
gbkey: Gene
gene: SPO0025
gene_biotype: protein_coding
load_id: gene-SPO0025
locus_tag: SPO0025
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00293
Source: Genbank
Position: CP000031.2:23831..24427 (+ strand)
Length: 597
"ID: cds-AAV93356.2
Dbxref: NCBI_GP:AAV93356.2
IMG: SPO0025: hydrolase
  NUDIX family
Note: identified by match to protein family HMM PF00293
RefSeq: SPO_RS00125: CoA pyrophosphatase"
gbkey: CDS
gene: SPO0025
locus_tag: SPO0025
parent_id: gene-SPO0025
product: hydrolase
  NUDIX family
protein_id: AAV93356.2
transl_table: 11
translation: MTDPIDSLMAALARTGPGSSDFDLNPGTILPEGRRLRPAGVLVPVTLAHGAPRVILTKRS SALKHHPGQIAFPGGKQDEGDADVIAAALREAEEEIGLTRTLPQVLGTLPAHETVTAFTV TPVVAVVERTFDVRPEPGEVEEVFSVPLAHLMRPENYSVQSRRWRGQRRHYFTVPFGPYY IWGATARMLRGLAERMQQ
>SPO0025 class=Sequence position=CP000031.2:23831..24427 (+ strand)
GTGACTGATC CGATCGACAG TTTGATGGCG GCCCTGGCCC GGACCGGGCC TGGGTCGAGC GACTTTGACC TCAACCCGGG
CACCATTCTA CCCGAGGGGC GCAGGCTGCG CCCCGCCGGG GTGCTGGTGC CGGTGACGCT GGCCCACGGT GCGCCCCGGG
TGATCCTGAC CAAGCGGTCC TCGGCGCTGA AACATCATCC GGGTCAGATC GCCTTTCCCG GCGGCAAACA GGACGAGGGC
GACGCGGATG TGATCGCCGC CGCCCTGCGC GAGGCCGAGG AAGAGATCGG TCTGACCCGC ACCCTGCCGC AGGTGCTGGG
CACCCTGCCG GCGCATGAGA CGGTGACCGC CTTTACCGTC ACGCCTGTGG TGGCGGTGGT CGAGCGCACC TTCGACGTCC
GGCCCGAGCC GGGCGAGGTC GAAGAGGTGT TCAGCGTGCC GCTCGCACAT CTGATGCGGC CCGAGAACTA CTCGGTTCAG
TCGCGCCGCT GGCGCGGACA GCGGCGGCAT TACTTCACCG TGCCTTTCGG GCCCTACTAC ATCTGGGGCG CCACCGCGCG
GATGCTGAGG GGGCTGGCCG AAAGGATGCA GCAATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7