Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0025
Type: CDS
Description: identified by match to protein family HMM PF00293; NCBI:coenzyme A pyrophosphatase; IMG:8-oxo-dGTP pyrophosphatase MutT; NUDIX family
Source: GenBank
Position: DSS3:23831..24427 (+ strand)
Length: 597
Dbxref: GI:564825955
  GeneID:3193819
Note: identified by match to protein family HMM PF00293
  NCBI:coenzyme A pyrophosphatase
  IMG:8-oxo-dGTP pyrophosphatase MutT
  NUDIX family
codon_start: 1
load_id: SPO0025.p01
parent_id: SPO0025.t01
product: hydrolase, NUDIX family
protein_id: REF_tigr:SPO0025
  YP_165298.2
transl_table: 11
translation: MTDPIDSLMAALARTGPGSSDFDLNPGTILPEGRRLRPAGVLVPVTLAHGAPRVILTKRS SALKHHPGQIAFPGGKQDEGDADVIAAALREAEEEIGLTRTLPQVLGTLPAHETVTAFTV TPVVAVVERTFDVRPEPGEVEEVFSVPLAHLMRPENYSVQSRRWRGQRRHYFTVPFGPYY IWGATARMLRGLAERMQQ
>SPO0025 class=Sequence position=DSS3:23831..24427 (+ strand)
GTGACTGATC CGATCGACAG TTTGATGGCG GCCCTGGCCC GGACCGGGCC TGGGTCGAGC GACTTTGACC TCAACCCGGG
CACCATTCTA CCCGAGGGGC GCAGGCTGCG CCCCGCCGGG GTGCTGGTGC CGGTGACGCT GGCCCACGGT GCGCCCCGGG
TGATCCTGAC CAAGCGGTCC TCGGCGCTGA AACATCATCC GGGTCAGATC GCCTTTCCCG GCGGCAAACA GGACGAGGGC
GACGCGGATG TGATCGCCGC CGCCCTGCGC GAGGCCGAGG AAGAGATCGG TCTGACCCGC ACCCTGCCGC AGGTGCTGGG
CACCCTGCCG GCGCATGAGA CGGTGACCGC CTTTACCGTC ACGCCTGTGG TGGCGGTGGT CGAGCGCACC TTCGACGTCC
GGCCCGAGCC GGGCGAGGTC GAAGAGGTGT TCAGCGTGCC GCTCGCACAT CTGATGCGGC CCGAGAACTA CTCGGTTCAG
TCGCGCCGCT GGCGCGGACA GCGGCGGCAT TACTTCACCG TGCCTTTCGG GCCCTACTAC ATCTGGGGCG CCACCGCGCG
GATGCTGAGG GGGCTGGCCG AAAGGATGCA GCAATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7