Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0026
Type: CDS
Description: identified by match to protein family HMM PF01743; NCBI:poly(A) polymerase; IMG:poly(A) polymerase
Source: GenBank
Position: DSS3:24424..25578 (+ strand)
Length: 1155
Dbxref: GI:56694954
  GeneID:3195220
Note: identified by match to protein family HMM PF01743
  NCBI:poly(A) polymerase
  IMG:poly(A) polymerase
codon_start: 1
load_id: SPO0026.p01
parent_id: SPO0026.t01
product: polyA polymerase family protein
protein_id: REF_tigr:SPO0026
  YP_165299.1
transl_table: 11
translation: MTRIDEAWLTEPATQQVCRALTEGGAQALFVGGCVRNALLGAPVSDIDITTDAHPERVMA LAAAAGIKAVPTGIAHGTVTLVANSIPHEVTTFRRDVETDGRRAVVAFSDSIHEDAARRD FTMNALYARPDGTVLDPLDGLPDLQARRVRFIGDATDRIREDYLRSLRYFRFHAWYGDAE AGFDAEALAAIAGNLDGLSRLSRERVGAEMLKLFAAPDPAPSVAAMRAAGVLAQLLPGAD DRALAPLVHLEDGLGADPIRRLAALGDGEALASLRLSKAQMALLDTLRRAALGTAGAGEL GHELGVEAARDALLLRAALLEQPLDPHAPAAIARGAAAVFPVTARDLMPAYSGPALGARL ATLKARWIASDFSLSRAALLVDKD
>SPO0026 class=Sequence position=DSS3:24424..25578 (+ strand)
ATGACCCGGA TTGACGAGGC ATGGCTGACC GAACCGGCGA CGCAACAGGT GTGCCGGGCC CTGACCGAGG GCGGTGCGCA
GGCGCTGTTC GTCGGTGGCT GTGTGCGCAA CGCACTGTTG GGCGCGCCGG TCAGCGATAT CGACATCACC ACCGACGCCC
ATCCCGAGCG GGTGATGGCG CTGGCCGCCG CGGCCGGGAT CAAGGCGGTT CCCACAGGCA TCGCCCATGG CACCGTGACG
CTGGTTGCCA ATAGCATTCC GCATGAGGTC ACCACTTTTC GCCGCGATGT GGAAACCGAC GGCCGCCGCG CGGTGGTCGC
CTTTTCCGAC TCGATCCACG AGGATGCCGC GCGGCGCGAT TTCACCATGA ACGCGCTTTA TGCCCGGCCC GACGGCACGG
TTCTGGACCC GTTGGATGGG CTGCCCGATC TACAGGCGCG GCGCGTGCGG TTCATCGGTG ATGCGACCGA CCGCATCCGC
GAGGATTACT TGCGCTCGCT GCGTTATTTC CGGTTTCACG CCTGGTATGG CGATGCCGAG GCCGGTTTCG ATGCCGAAGC
GCTGGCGGCG ATTGCCGGTA ATCTCGACGG GCTGTCCCGC CTCTCGCGCG AGAGGGTGGG GGCCGAGATG TTGAAACTGT
TCGCCGCGCC CGACCCGGCG CCCTCGGTCG CTGCCATGCG CGCCGCCGGG GTGCTGGCCC AGCTTCTGCC CGGTGCGGAT
GATCGGGCGC TGGCGCCGCT GGTACATCTG GAAGACGGGT TGGGGGCCGA TCCGATCCGG CGGCTGGCCG CGCTGGGCGA
CGGCGAAGCA CTGGCCTCGC TCCGGTTGAG CAAGGCGCAG ATGGCGTTGC TGGACACGCT GCGCCGAGCT GCTTTGGGCA
CCGCCGGGGC CGGAGAGTTG GGGCACGAAC TGGGCGTCGA GGCGGCGCGC GATGCACTTC TTCTGCGGGC CGCGCTGCTG
GAACAACCGC TTGACCCGCA CGCGCCCGCC GCCATTGCGC GCGGGGCTGC GGCGGTGTTT CCGGTCACTG CCCGCGATCT
GATGCCAGCC TATTCTGGCC CCGCGCTGGG CGCGCGGCTT GCCACGCTAA AGGCGCGCTG GATCGCCTCG GACTTCAGCC
TGAGCAGGGC GGCTTTGCTG GTTGACAAGG ATTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7