Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0027
Type: gene
Description:
Source: GenBank
Position: DSS3:25770..27608 (+ strand)
Length: 1839
Dbxref: GeneID:3196318
load_id: SPO0027
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:25770..27608 (+ strand)
Length: 1839
load_id: SPO0027.t01
parent_id: SPO0027
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00005; match to protein family HMM PF00664; NCBI:multidrug ABC transporter ATP-binding protein; IMG:ATP-binding cassette; subfamily B; multidrug efflux pump
Source: GenBank
Position: DSS3:25770..27608 (+ strand)
Length: 1839
Dbxref: GI:56694955
  GeneID:3196318
Note: identified by match to protein family HMM PF00005; match to protein family HMM PF00664
  NCBI:multidrug ABC transporter ATP-binding protein
  IMG:ATP-binding cassette
  subfamily B
  multidrug efflux pump
codon_start: 1
load_id: SPO0027.p01
parent_id: SPO0027.t01
product: ABC transporter, transmembrane ATP-binding protein
protein_id: REF_tigr:SPO0027
  YP_165300.1
transl_table: 11
translation: MFRFFENLVDPFVAYDETDTPPTRLWPFMLDYSQPFLRVFVWTALLSIIVAGVEIGLIYY MGRVVDVLNGEPAEVWARYGTEFIVLALFVLLIRPALHVADVLLLNNAILPNFGTLIRWR AHKHVLRQSVGWFENDFAGRIANRIMQTPPAAGEVIFQVFDAISFSLAYLLGAAILLMAA DIRLLLPLLIWFALYALLVRWTIQRVGPASQAASDARSTVTGRVVDSYTNIHSVKMFAHD DRELTYAREAIEETRRTFQVEMRIFTIMDVVLVTLNGLLIVGVVGWAIALWMQGQASVGL VAAASALTLRLNAMTGWIMWALTSFFRQLGVVAEGMETIAQPIDLVDAPDARPLELSEGR IELQQLSHHYGRGAGGLDQLDLTIAPGEKIGLIGRSGAGKSTLVKLLLRFYDPDSGRILI DGQDIARVTQNSLRSHIGMVQQDSALLHRSVRDNLLYGRPDASEDEMIAAAKQAEAHDFI LDLEDPQGRRGYDAHVGERGVKLSGGQRQRVTLARVILKNAPILLLDEATSALDSEVEAA IQDTLYGMMEGKTVIAIAHRLSTIAQMDRILVLDQGRIVEEGDHADLLAQGGLYAQFWAR QSGGFLNTEAAE
Type: exon
Description:
Source: GenBank
Position: DSS3:25770..27608 (+ strand)
Length: 1839
parent_id: SPO0027.t01
> class=Sequence position=DSS3:25770..27608 (+ strand)
ATGTTTCGCT TTTTCGAAAA TCTTGTCGAT CCCTTTGTCG CCTATGACGA GACCGACACG CCGCCCACCC GGTTGTGGCC
CTTTATGCTG GATTACTCCC AGCCGTTTCT GCGCGTCTTT GTCTGGACTG CGCTGCTGTC GATCATCGTC GCCGGGGTCG
AGATCGGGCT GATCTACTAC ATGGGCCGTG TCGTCGATGT GTTGAACGGC GAACCGGCCG AGGTCTGGGC GCGCTACGGC
ACCGAGTTCA TCGTGCTGGC ACTGTTCGTC CTGCTGATCC GGCCTGCGCT GCATGTGGCC GATGTGCTGC TGTTGAACAA
TGCGATCCTG CCCAATTTCG GCACCCTGAT CCGCTGGCGC GCGCATAAAC ACGTATTGCG CCAGTCGGTC GGCTGGTTCG
AGAATGATTT TGCCGGGCGC ATCGCCAACC GGATCATGCA GACCCCCCCG GCGGCGGGCG AGGTGATCTT TCAGGTTTTC
GACGCGATCT CGTTTTCGCT GGCCTATCTG TTGGGCGCGG CGATCTTGCT TATGGCGGCC GACATCCGGC TGCTGCTGCC
ATTGCTGATC TGGTTCGCGC TTTATGCTTT GCTGGTGCGC TGGACGATCC AGCGGGTTGG GCCAGCGTCG CAGGCGGCCT
CGGATGCGCG TTCGACCGTG ACGGGGCGGG TGGTGGACAG CTATACCAAC ATCCATTCGG TCAAGATGTT CGCCCATGAC
GACCGCGAGC TGACCTATGC CCGCGAAGCG ATCGAGGAAA CGCGCCGCAC CTTTCAGGTG GAAATGCGGA TCTTTACCAT
CATGGACGTG GTGCTGGTCA CCCTGAACGG GCTGCTGATC GTCGGCGTGG TTGGCTGGGC CATCGCGCTC TGGATGCAGG
GGCAGGCCAG TGTCGGCCTG GTGGCCGCAG CCTCGGCCCT GACCCTGCGG CTGAACGCGA TGACCGGCTG GATCATGTGG
GCGCTGACCA GTTTCTTTCG CCAATTGGGT GTGGTGGCCG AGGGGATGGA AACCATCGCC CAGCCCATCG ACCTGGTGGA
TGCGCCGGAT GCCCGGCCGC TGGAGCTGAG CGAGGGCCGG ATCGAACTGC AACAGCTGTC GCATCACTAT GGGCGCGGCG
CCGGCGGGCT GGACCAGTTG GACCTGACAA TTGCGCCGGG TGAAAAGATC GGGCTGATCG GACGCTCGGG CGCGGGCAAG
TCGACGCTGG TCAAGCTGCT GCTCCGGTTC TACGACCCCG ATAGCGGTCG CATCCTGATC GACGGACAGG ATATCGCCCG
GGTGACCCAG AACAGTCTGC GCAGCCATAT CGGCATGGTG CAGCAGGACA GCGCCCTGTT GCACCGCTCG GTCCGTGACA
ACCTGCTTTA TGGTCGTCCC GACGCGAGTG AGGACGAGAT GATCGCCGCC GCCAAACAGG CCGAGGCGCA TGACTTCATC
CTGGACCTCG AAGATCCGCA GGGCAGGCGC GGCTATGATG CCCATGTGGG CGAGCGCGGC GTCAAGCTGA GCGGCGGGCA
ACGCCAGCGG GTGACCCTGG CGCGGGTCAT TCTGAAGAAC GCGCCCATTT TGCTGTTGGA CGAGGCGACC AGCGCGCTAG
ATTCCGAGGT CGAGGCCGCC ATTCAGGACA CGCTCTACGG CATGATGGAA GGAAAGACCG TGATCGCCAT CGCTCACCGG
CTGAGCACAA TCGCCCAGAT GGACCGTATC CTGGTGCTGG ATCAGGGCCG GATCGTTGAA GAGGGCGATC ATGCCGACCT
GCTGGCGCAG GGCGGGCTCT ATGCCCAGTT CTGGGCACGG CAATCGGGCG GGTTTCTGAA CACCGAGGCC GCTGAATGA
>SPO0027 class=Sequence position=DSS3:25770..27608 (+ strand)
ATGTTTCGCT TTTTCGAAAA TCTTGTCGAT CCCTTTGTCG CCTATGACGA GACCGACACG CCGCCCACCC GGTTGTGGCC
CTTTATGCTG GATTACTCCC AGCCGTTTCT GCGCGTCTTT GTCTGGACTG CGCTGCTGTC GATCATCGTC GCCGGGGTCG
AGATCGGGCT GATCTACTAC ATGGGCCGTG TCGTCGATGT GTTGAACGGC GAACCGGCCG AGGTCTGGGC GCGCTACGGC
ACCGAGTTCA TCGTGCTGGC ACTGTTCGTC CTGCTGATCC GGCCTGCGCT GCATGTGGCC GATGTGCTGC TGTTGAACAA
TGCGATCCTG CCCAATTTCG GCACCCTGAT CCGCTGGCGC GCGCATAAAC ACGTATTGCG CCAGTCGGTC GGCTGGTTCG
AGAATGATTT TGCCGGGCGC ATCGCCAACC GGATCATGCA GACCCCCCCG GCGGCGGGCG AGGTGATCTT TCAGGTTTTC
GACGCGATCT CGTTTTCGCT GGCCTATCTG TTGGGCGCGG CGATCTTGCT TATGGCGGCC GACATCCGGC TGCTGCTGCC
ATTGCTGATC TGGTTCGCGC TTTATGCTTT GCTGGTGCGC TGGACGATCC AGCGGGTTGG GCCAGCGTCG CAGGCGGCCT
CGGATGCGCG TTCGACCGTG ACGGGGCGGG TGGTGGACAG CTATACCAAC ATCCATTCGG TCAAGATGTT CGCCCATGAC
GACCGCGAGC TGACCTATGC CCGCGAAGCG ATCGAGGAAA CGCGCCGCAC CTTTCAGGTG GAAATGCGGA TCTTTACCAT
CATGGACGTG GTGCTGGTCA CCCTGAACGG GCTGCTGATC GTCGGCGTGG TTGGCTGGGC CATCGCGCTC TGGATGCAGG
GGCAGGCCAG TGTCGGCCTG GTGGCCGCAG CCTCGGCCCT GACCCTGCGG CTGAACGCGA TGACCGGCTG GATCATGTGG
GCGCTGACCA GTTTCTTTCG CCAATTGGGT GTGGTGGCCG AGGGGATGGA AACCATCGCC CAGCCCATCG ACCTGGTGGA
TGCGCCGGAT GCCCGGCCGC TGGAGCTGAG CGAGGGCCGG ATCGAACTGC AACAGCTGTC GCATCACTAT GGGCGCGGCG
CCGGCGGGCT GGACCAGTTG GACCTGACAA TTGCGCCGGG TGAAAAGATC GGGCTGATCG GACGCTCGGG CGCGGGCAAG
TCGACGCTGG TCAAGCTGCT GCTCCGGTTC TACGACCCCG ATAGCGGTCG CATCCTGATC GACGGACAGG ATATCGCCCG
GGTGACCCAG AACAGTCTGC GCAGCCATAT CGGCATGGTG CAGCAGGACA GCGCCCTGTT GCACCGCTCG GTCCGTGACA
ACCTGCTTTA TGGTCGTCCC GACGCGAGTG AGGACGAGAT GATCGCCGCC GCCAAACAGG CCGAGGCGCA TGACTTCATC
CTGGACCTCG AAGATCCGCA GGGCAGGCGC GGCTATGATG CCCATGTGGG CGAGCGCGGC GTCAAGCTGA GCGGCGGGCA
ACGCCAGCGG GTGACCCTGG CGCGGGTCAT TCTGAAGAAC GCGCCCATTT TGCTGTTGGA CGAGGCGACC AGCGCGCTAG
ATTCCGAGGT CGAGGCCGCC ATTCAGGACA CGCTCTACGG CATGATGGAA GGAAAGACCG TGATCGCCAT CGCTCACCGG
CTGAGCACAA TCGCCCAGAT GGACCGTATC CTGGTGCTGG ATCAGGGCCG GATCGTTGAA GAGGGCGATC ATGCCGACCT
GCTGGCGCAG GGCGGGCTCT ATGCCCAGTT CTGGGCACGG CAATCGGGCG GGTTTCTGAA CACCGAGGCC GCTGAATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7