Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0028
Type: gene
Description:
Source: Genbank
Position: CP000031.2:27605..29437 (+ strand)
Length: 1833
gbkey: Gene
gene: SPO0028
gene_biotype: protein_coding
load_id: gene-SPO0028
locus_tag: SPO0028
Parts:
Type: CDS
Description: identified by similarity to GB:BAB70471.1; match to protein family HMM PF00005; match to protein family HMM PF00664
Source: Genbank
Position: CP000031.2:27605..29437 (+ strand)
Length: 1833
"ID: cds-AAV93359.1
Dbxref: NCBI_GP:AAV93359.1
IMG: SPO0028: ABC transporter
  transmembrane ATP-binding protein
Note: identified by similarity to GB:BAB70471.1; match to protein family HMM PF00005; match to protein family HMM PF00664
RefSeq: SPO_RS00140: ABC transporter ATP-binding protein"
gbkey: CDS
gene: SPO0028
locus_tag: SPO0028
parent_id: gene-SPO0028
product: ABC transporter
  transmembrane ATP-binding protein
protein_id: AAV93359.1
transl_table: 11
translation: MRFADLIDPFRDTDTPPPQRLGAFIRWALSGAWPVLFVAALFSALAGMFEAITAWILGQV VDRAVELGPEGFFEGTNLATILVAVGFFVLIRPVAFGLSAFSNNYIVMPNIPPLVLAKLN RWTLGQSVGFFDDDFAGRIAQKQMQTASALSSVVSETISAIVFALASLIGSLALLGSIHP LVMLPFAVWLCGYFLLIRWYLPRVRKRSAARAGARAMVSGQVVDTITNIKTVKLFAHAEA EDVTARNAMADLRERSLDFGWLSASFRFFLMLLAGVLPVILLGSALILWRAGDASAGDVV VAGSVSIRIAQMSGWVSFTLMSLYANLGEVQNGMNSLARAERIEDVADARPLVAGAGKID FEDVGFAYGRKSGGVDALSLTVAPGEKLGIVGASGAGKSTLVSLLLRLYEAENGQIRIDG QDITTVTQDSLRRQIGLVTQETAMFNRSARENILYGRPNASEAELIAAAQKAEAHDFILD LADAKGRTGYDAHLGERGVKLSGGQRQRIALARAILKDAPILVLDEATSALDSEVEASIQ TALHRVMEGKTVLAIAHRLSTLSEMDRIVVLDRGRIVESGTHEALLARDGLYARFWHRQS GGFIRTQAAE
>SPO0028 class=Sequence position=CP000031.2:27605..29437 (+ strand)
ATGAGGTTTG CCGACCTCAT CGACCCGTTT CGTGACACCG ACACGCCCCC GCCCCAGCGG CTGGGGGCGT TCATTCGCTG
GGCATTGAGC GGCGCCTGGC CGGTTCTATT CGTCGCCGCC CTGTTTTCTG CCCTGGCAGG CATGTTCGAG GCGATTACCG
CGTGGATACT GGGGCAGGTG GTCGACCGGG CGGTCGAACT TGGTCCCGAA GGGTTTTTTG AGGGCACCAA CCTGGCGACA
ATCCTGGTTG CAGTGGGCTT TTTCGTGTTG ATCCGGCCGG TTGCCTTTGG CCTGTCGGCC TTCTCCAACA ACTATATCGT
CATGCCCAAT ATCCCGCCGC TTGTGCTGGC CAAGCTGAAT CGGTGGACGC TGGGACAATC GGTGGGCTTC TTTGATGACG
ATTTCGCCGG TCGGATCGCG CAGAAACAGA TGCAGACGGC AAGCGCGCTC AGCTCGGTGG TATCCGAGAC CATCAGCGCG
ATCGTCTTTG CACTGGCATC GCTGATCGGC AGTTTGGCCT TGTTAGGGTC TATTCATCCA CTGGTCATGT TGCCTTTTGC
GGTGTGGCTT TGTGGCTATT TTCTGCTGAT CCGCTGGTAT CTGCCACGGG TTCGCAAACG ATCGGCGGCG CGGGCGGGAG
CGCGGGCGAT GGTGTCGGGC CAGGTAGTGG ACACGATCAC CAATATCAAG ACGGTCAAGC TGTTCGCACA TGCCGAGGCC
GAGGATGTGA CCGCGCGCAA TGCCATGGCC GACCTGCGCG AGAGGTCGCT GGATTTCGGC TGGCTTTCGG CCAGTTTCCG
GTTCTTCCTG ATGTTGCTGG CGGGTGTCTT GCCGGTGATC CTGCTGGGTT CGGCGCTGAT TCTCTGGCGG GCAGGGGATG
CCAGCGCGGG CGACGTTGTG GTCGCCGGAT CGGTCTCCAT CCGTATCGCG CAGATGTCCG GTTGGGTCAG TTTCACGCTG
ATGAGCCTTT ATGCCAACCT GGGAGAGGTG CAGAACGGCA TGAACAGTCT TGCGCGGGCT GAACGTATCG AGGATGTCGC
GGATGCGCGG CCTTTGGTTG CGGGCGCTGG CAAGATCGAT TTCGAGGATG TCGGCTTTGC CTATGGGCGA AAATCCGGCG
GGGTCGATGC GTTGTCGCTG ACCGTTGCGC CGGGCGAAAA ACTGGGGATT GTCGGTGCCT CAGGGGCGGG CAAGTCGACG
CTGGTTTCGT TGCTGCTCAG GCTCTATGAA GCGGAAAACG GACAAATCCG CATTGACGGG CAGGATATCA CTACCGTGAC
GCAGGACAGT TTGCGGCGGC AGATCGGGCT GGTGACGCAA GAGACGGCGA TGTTCAATCG TTCGGCCCGC GAGAACATCC
TTTATGGCCG CCCAAATGCG AGCGAGGCCG AGTTGATCGC CGCCGCGCAA AAGGCCGAGG CGCATGACTT CATCCTGGAT
CTTGCCGACG CCAAGGGACG CACCGGATAT GACGCCCATC TGGGCGAGCG TGGCGTCAAG CTGAGCGGTG GTCAGCGGCA
GCGGATTGCG CTGGCGCGCG CTATCCTCAA AGACGCGCCG ATCCTGGTGC TGGACGAGGC AACCAGCGCG CTTGACAGCG
AGGTCGAGGC GTCGATCCAG ACCGCGCTGC ACCGGGTGAT GGAGGGCAAG ACCGTGCTGG CCATCGCGCA CCGTCTGTCG
ACCCTGTCGG AAATGGACCG GATCGTGGTG CTGGATCGCG GCCGGATCGT CGAAAGCGGC ACGCATGAAG CGCTTTTGGC
GCGCGACGGT CTCTATGCCC GGTTCTGGCA TCGTCAGTCG GGTGGCTTTA TTCGCACCCA GGCCGCCGAG TAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7