Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0028
Type: gene
Description:
Source: GenBank
Position: DSS3:27605..29437 (+ strand)
Length: 1833
Dbxref: GeneID:3194381
load_id: SPO0028
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:27605..29437 (+ strand)
Length: 1833
load_id: SPO0028.t01
parent_id: SPO0028
Parts:
Type: CDS
Description: identified by similarity to GB:BAB70471.1; match to protein family HMM PF00005; match to protein family HMM PF00664; NCBI:multidrug ABC transporter ATPase; IMG:ATP-binding cassette; subfamily B
Source: GenBank
Position: DSS3:27605..29437 (+ strand)
Length: 1833
Dbxref: GI:56694956
  GeneID:3194381
Note: identified by similarity to GB:BAB70471.1; match to protein family HMM PF00005; match to protein family HMM PF00664
  NCBI:multidrug ABC transporter ATPase
  IMG:ATP-binding cassette
  subfamily B
codon_start: 1
load_id: SPO0028.p01
parent_id: SPO0028.t01
product: ABC transporter, transmembrane ATP-binding protein
protein_id: REF_tigr:SPO0028
  YP_165301.1
transl_table: 11
translation: MRFADLIDPFRDTDTPPPQRLGAFIRWALSGAWPVLFVAALFSALAGMFEAITAWILGQV VDRAVELGPEGFFEGTNLATILVAVGFFVLIRPVAFGLSAFSNNYIVMPNIPPLVLAKLN RWTLGQSVGFFDDDFAGRIAQKQMQTASALSSVVSETISAIVFALASLIGSLALLGSIHP LVMLPFAVWLCGYFLLIRWYLPRVRKRSAARAGARAMVSGQVVDTITNIKTVKLFAHAEA EDVTARNAMADLRERSLDFGWLSASFRFFLMLLAGVLPVILLGSALILWRAGDASAGDVV VAGSVSIRIAQMSGWVSFTLMSLYANLGEVQNGMNSLARAERIEDVADARPLVAGAGKID FEDVGFAYGRKSGGVDALSLTVAPGEKLGIVGASGAGKSTLVSLLLRLYEAENGQIRIDG QDITTVTQDSLRRQIGLVTQETAMFNRSARENILYGRPNASEAELIAAAQKAEAHDFILD LADAKGRTGYDAHLGERGVKLSGGQRQRIALARAILKDAPILVLDEATSALDSEVEASIQ TALHRVMEGKTVLAIAHRLSTLSEMDRIVVLDRGRIVESGTHEALLARDGLYARFWHRQS GGFIRTQAAE
Type: exon
Description:
Source: GenBank
Position: DSS3:27605..29437 (+ strand)
Length: 1833
parent_id: SPO0028.t01
> class=Sequence position=DSS3:27605..29437 (+ strand)
ATGAGGTTTG CCGACCTCAT CGACCCGTTT CGTGACACCG ACACGCCCCC GCCCCAGCGG CTGGGGGCGT TCATTCGCTG
GGCATTGAGC GGCGCCTGGC CGGTTCTATT CGTCGCCGCC CTGTTTTCTG CCCTGGCAGG CATGTTCGAG GCGATTACCG
CGTGGATACT GGGGCAGGTG GTCGACCGGG CGGTCGAACT TGGTCCCGAA GGGTTTTTTG AGGGCACCAA CCTGGCGACA
ATCCTGGTTG CAGTGGGCTT TTTCGTGTTG ATCCGGCCGG TTGCCTTTGG CCTGTCGGCC TTCTCCAACA ACTATATCGT
CATGCCCAAT ATCCCGCCGC TTGTGCTGGC CAAGCTGAAT CGGTGGACGC TGGGACAATC GGTGGGCTTC TTTGATGACG
ATTTCGCCGG TCGGATCGCG CAGAAACAGA TGCAGACGGC AAGCGCGCTC AGCTCGGTGG TATCCGAGAC CATCAGCGCG
ATCGTCTTTG CACTGGCATC GCTGATCGGC AGTTTGGCCT TGTTAGGGTC TATTCATCCA CTGGTCATGT TGCCTTTTGC
GGTGTGGCTT TGTGGCTATT TTCTGCTGAT CCGCTGGTAT CTGCCACGGG TTCGCAAACG ATCGGCGGCG CGGGCGGGAG
CGCGGGCGAT GGTGTCGGGC CAGGTAGTGG ACACGATCAC CAATATCAAG ACGGTCAAGC TGTTCGCACA TGCCGAGGCC
GAGGATGTGA CCGCGCGCAA TGCCATGGCC GACCTGCGCG AGAGGTCGCT GGATTTCGGC TGGCTTTCGG CCAGTTTCCG
GTTCTTCCTG ATGTTGCTGG CGGGTGTCTT GCCGGTGATC CTGCTGGGTT CGGCGCTGAT TCTCTGGCGG GCAGGGGATG
CCAGCGCGGG CGACGTTGTG GTCGCCGGAT CGGTCTCCAT CCGTATCGCG CAGATGTCCG GTTGGGTCAG TTTCACGCTG
ATGAGCCTTT ATGCCAACCT GGGAGAGGTG CAGAACGGCA TGAACAGTCT TGCGCGGGCT GAACGTATCG AGGATGTCGC
GGATGCGCGG CCTTTGGTTG CGGGCGCTGG CAAGATCGAT TTCGAGGATG TCGGCTTTGC CTATGGGCGA AAATCCGGCG
GGGTCGATGC GTTGTCGCTG ACCGTTGCGC CGGGCGAAAA ACTGGGGATT GTCGGTGCCT CAGGGGCGGG CAAGTCGACG
CTGGTTTCGT TGCTGCTCAG GCTCTATGAA GCGGAAAACG GACAAATCCG CATTGACGGG CAGGATATCA CTACCGTGAC
GCAGGACAGT TTGCGGCGGC AGATCGGGCT GGTGACGCAA GAGACGGCGA TGTTCAATCG TTCGGCCCGC GAGAACATCC
TTTATGGCCG CCCAAATGCG AGCGAGGCCG AGTTGATCGC CGCCGCGCAA AAGGCCGAGG CGCATGACTT CATCCTGGAT
CTTGCCGACG CCAAGGGACG CACCGGATAT GACGCCCATC TGGGCGAGCG TGGCGTCAAG CTGAGCGGTG GTCAGCGGCA
GCGGATTGCG CTGGCGCGCG CTATCCTCAA AGACGCGCCG ATCCTGGTGC TGGACGAGGC AACCAGCGCG CTTGACAGCG
AGGTCGAGGC GTCGATCCAG ACCGCGCTGC ACCGGGTGAT GGAGGGCAAG ACCGTGCTGG CCATCGCGCA CCGTCTGTCG
ACCCTGTCGG AAATGGACCG GATCGTGGTG CTGGATCGCG GCCGGATCGT CGAAAGCGGC ACGCATGAAG CGCTTTTGGC
GCGCGACGGT CTCTATGCCC GGTTCTGGCA TCGTCAGTCG GGTGGCTTTA TTCGCACCCA GGCCGCCGAG TAA
>SPO0028 class=Sequence position=DSS3:27605..29437 (+ strand)
ATGAGGTTTG CCGACCTCAT CGACCCGTTT CGTGACACCG ACACGCCCCC GCCCCAGCGG CTGGGGGCGT TCATTCGCTG
GGCATTGAGC GGCGCCTGGC CGGTTCTATT CGTCGCCGCC CTGTTTTCTG CCCTGGCAGG CATGTTCGAG GCGATTACCG
CGTGGATACT GGGGCAGGTG GTCGACCGGG CGGTCGAACT TGGTCCCGAA GGGTTTTTTG AGGGCACCAA CCTGGCGACA
ATCCTGGTTG CAGTGGGCTT TTTCGTGTTG ATCCGGCCGG TTGCCTTTGG CCTGTCGGCC TTCTCCAACA ACTATATCGT
CATGCCCAAT ATCCCGCCGC TTGTGCTGGC CAAGCTGAAT CGGTGGACGC TGGGACAATC GGTGGGCTTC TTTGATGACG
ATTTCGCCGG TCGGATCGCG CAGAAACAGA TGCAGACGGC AAGCGCGCTC AGCTCGGTGG TATCCGAGAC CATCAGCGCG
ATCGTCTTTG CACTGGCATC GCTGATCGGC AGTTTGGCCT TGTTAGGGTC TATTCATCCA CTGGTCATGT TGCCTTTTGC
GGTGTGGCTT TGTGGCTATT TTCTGCTGAT CCGCTGGTAT CTGCCACGGG TTCGCAAACG ATCGGCGGCG CGGGCGGGAG
CGCGGGCGAT GGTGTCGGGC CAGGTAGTGG ACACGATCAC CAATATCAAG ACGGTCAAGC TGTTCGCACA TGCCGAGGCC
GAGGATGTGA CCGCGCGCAA TGCCATGGCC GACCTGCGCG AGAGGTCGCT GGATTTCGGC TGGCTTTCGG CCAGTTTCCG
GTTCTTCCTG ATGTTGCTGG CGGGTGTCTT GCCGGTGATC CTGCTGGGTT CGGCGCTGAT TCTCTGGCGG GCAGGGGATG
CCAGCGCGGG CGACGTTGTG GTCGCCGGAT CGGTCTCCAT CCGTATCGCG CAGATGTCCG GTTGGGTCAG TTTCACGCTG
ATGAGCCTTT ATGCCAACCT GGGAGAGGTG CAGAACGGCA TGAACAGTCT TGCGCGGGCT GAACGTATCG AGGATGTCGC
GGATGCGCGG CCTTTGGTTG CGGGCGCTGG CAAGATCGAT TTCGAGGATG TCGGCTTTGC CTATGGGCGA AAATCCGGCG
GGGTCGATGC GTTGTCGCTG ACCGTTGCGC CGGGCGAAAA ACTGGGGATT GTCGGTGCCT CAGGGGCGGG CAAGTCGACG
CTGGTTTCGT TGCTGCTCAG GCTCTATGAA GCGGAAAACG GACAAATCCG CATTGACGGG CAGGATATCA CTACCGTGAC
GCAGGACAGT TTGCGGCGGC AGATCGGGCT GGTGACGCAA GAGACGGCGA TGTTCAATCG TTCGGCCCGC GAGAACATCC
TTTATGGCCG CCCAAATGCG AGCGAGGCCG AGTTGATCGC CGCCGCGCAA AAGGCCGAGG CGCATGACTT CATCCTGGAT
CTTGCCGACG CCAAGGGACG CACCGGATAT GACGCCCATC TGGGCGAGCG TGGCGTCAAG CTGAGCGGTG GTCAGCGGCA
GCGGATTGCG CTGGCGCGCG CTATCCTCAA AGACGCGCCG ATCCTGGTGC TGGACGAGGC AACCAGCGCG CTTGACAGCG
AGGTCGAGGC GTCGATCCAG ACCGCGCTGC ACCGGGTGAT GGAGGGCAAG ACCGTGCTGG CCATCGCGCA CCGTCTGTCG
ACCCTGTCGG AAATGGACCG GATCGTGGTG CTGGATCGCG GCCGGATCGT CGAAAGCGGC ACGCATGAAG CGCTTTTGGC
GCGCGACGGT CTCTATGCCC GGTTCTGGCA TCGTCAGTCG GGTGGCTTTA TTCGCACCCA GGCCGCCGAG TAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7