Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0030
Type: CDS
Description: identified by similarity to GB:CAD24429.1; match to protein family HMM PF00520; NCBI:voltage-gated sodium channel; IMG:voltage-gated sodium channel
Source: GenBank
Position: DSS3:30727..31503 (+ strand)
Length: 777
Dbxref: GI:56694958
  GeneID:3195038
Note: identified by similarity to GB:CAD24429.1; match to protein family HMM PF00520
  NCBI:voltage-gated sodium channel
  IMG:voltage-gated sodium channel
codon_start: 1
load_id: SPO0030.p01
parent_id: SPO0030.t01
product: voltage-gated sodium channel
protein_id: REF_tigr:SPO0030
  YP_165303.1
transl_table: 11
translation: MQRMQAFIDRPGFGRFITAVIMLNAVVLGMETSPYLMERWGGLILAADRICLGIFIVEIA LKLTAQRQRFFLNGWNLFDFVIVGIALIPAAGGLSVLRALRILRVLRVISVAPRLRRVVE GFITALPGMASVFLLMTIIFYIGAVIATKLFAASFPDWFGDLGLSAYTLFQIMTLESWSM GIVRPVMQVYPYAWLFFVPFIMITTFAVVNLLVGLIVNSMQDAHHAEDGERTDAYRDEVL ARLEQIDQRLNALGETKK
>SPO0030 class=Sequence position=DSS3:30727..31503 (+ strand)
ATGCAAAGAA TGCAGGCCTT TATCGACCGG CCCGGTTTCG GCCGGTTCAT TACCGCCGTG ATCATGCTGA ACGCCGTCGT
GCTGGGGATG GAGACGTCGC CCTATCTGAT GGAGCGGTGG GGCGGGCTGA TCCTGGCCGC TGACCGTATC TGCCTAGGCA
TCTTCATCGT CGAGATCGCG CTGAAACTGA CGGCGCAGCG GCAGCGCTTT TTCCTGAACG GCTGGAACCT GTTCGATTTC
GTGATCGTCG GGATCGCCCT GATCCCCGCC GCCGGGGGTC TGTCGGTGCT GCGGGCGCTG CGCATCCTGC GGGTGCTTCG
CGTGATCTCG GTCGCGCCGC GCTTGCGCCG CGTGGTCGAA GGCTTCATCA CTGCGCTGCC CGGCATGGCC AGCGTGTTTC
TGTTGATGAC CATCATCTTC TACATCGGCG CGGTGATCGC GACCAAGCTG TTCGCCGCCT CCTTTCCCGA CTGGTTCGGC
GATCTGGGTC TGTCGGCCTA TACGCTGTTC CAGATCATGA CGCTGGAAAG CTGGTCGATG GGCATCGTTC GCCCGGTGAT
GCAGGTCTAT CCCTATGCCT GGCTGTTCTT TGTCCCCTTC ATCATGATCA CCACATTTGC GGTGGTTAAC CTGCTGGTCG
GTCTGATCGT GAACTCGATG CAGGACGCTC ATCACGCCGA GGATGGCGAG CGGACCGATG CCTATCGGGA CGAGGTTCTG
GCCCGCCTGG AACAGATCGA CCAGCGGCTG AATGCGCTTG GTGAAACCAA AAAGTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7