Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0031
Type: CDS
Description: identified by match to protein family HMM PF03734; NCBI:transpeptidase; IMG:L; D-transpeptidase catalytic domain
Source: GenBank
Position: DSS3:31568..32086 (+ strand)
Length: 519
Dbxref: GI:564825956
  GeneID:3194916
Note: identified by match to protein family HMM PF03734
  NCBI:transpeptidase
  IMG:L
  D-transpeptidase catalytic domain
codon_start: 1
load_id: SPO0031.p01
parent_id: SPO0031.t01
product: ErfK/YbiS/YcfS/YnhG family protein
protein_id: REF_tigr:SPO0031
  YP_165304.2
transl_table: 11
translation: MDRRHFGLGAAAALGLSACGSQDSKFRRYYGPAVTSIVINKGARKMYLLNNEKVLKEYKV ELGFAPAGHKQFEGDGKTPEGTYLIDRRNPNSAFHLSLGISYPNSRDVAYAQAMGKKPGG EIFIHGEPNGLRDRKKAKKQPDWTAGCIAVKNDEIEEIYAMVRDGTVITLRA
>SPO0031 class=Sequence position=DSS3:31568..32086 (+ strand)
ATGGATCGTC GGCATTTTGG TCTTGGCGCG GCCGCCGCGC TTGGCCTGTC GGCCTGCGGC AGCCAGGACA GCAAGTTCCG
CCGCTATTAC GGGCCTGCGG TCACCTCGAT CGTGATCAAC AAGGGCGCGC GTAAGATGTA CCTGTTGAAC AACGAAAAGG
TGCTGAAGGA GTACAAGGTC GAACTGGGTT TTGCCCCGGC AGGGCACAAA CAGTTCGAAG GCGACGGCAA GACGCCCGAG
GGCACCTATC TGATCGACCG GCGCAATCCC AACAGCGCAT TCCATCTGTC GCTGGGCATC TCTTATCCCA ACTCGCGCGA
TGTGGCCTAT GCCCAGGCGA TGGGCAAGAA GCCGGGCGGC GAAATCTTCA TTCATGGCGA GCCCAATGGG TTGCGCGACC
GCAAGAAGGC AAAGAAACAG CCGGATTGGA CCGCTGGCTG CATCGCCGTC AAGAATGACG AGATCGAAGA GATCTATGCC
ATGGTGCGCG ATGGGACGGT GATCACCCTG CGCGCCTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7