Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0033
Type: CDS
Description: identified by match to protein family HMM PF00126; match to protein family HMM PF03466
Source: Genbank
Position: CP000031.2:32458..33366 (+ strand)
Length: 909
"ID: cds-AAV93364.1
Dbxref: NCBI_GP:AAV93364.1
IMG: SPO0033: transcriptional regulator
  LysR family
Note: identified by match to protein family HMM PF00126; match to protein family HMM PF03466
RefSeq: SPO_RS00165: LysR family transcriptional regulator"
gbkey: CDS
gene: SPO0033
locus_tag: SPO0033
parent_id: gene-SPO0033
product: transcriptional regulator
  LysR family
protein_id: AAV93364.1
transl_table: 11
translation: MRLPPLNALRAFEAAARHNGYIAAAEELCVTRGAVSRHIKLLEDHLGVTLFHRNHRGVEL TAAGRQLLPVLTETFARIAREAEQISAMTRDVRIICPPALSIRWLFPRLEEFQAAHPDIR VRLTTEFYGAKGFDDTEHDLGVSVEHVSGRGAGIASMPLFPMVLSPACSPALLRQRPLSA PADLARMTLLHESPQRRDWAHWLSSFGVRGVDAGSGPTFPNLDMAARAATMGAGVVMADL ALCQEELRAGTLVLPFPEMTCTTPQGGYVLLGARARWDEPHLRAFRDWAASSSADLVACM GA
>SPO0033 class=Sequence position=CP000031.2:32458..33366 (+ strand)
ATGCGCTTGC CGCCGCTGAA CGCCCTGCGC GCTTTCGAAG CCGCCGCACG CCATAACGGC TATATCGCGG CCGCCGAAGA
GCTCTGCGTG ACCCGTGGCG CTGTCAGCCG TCATATCAAG CTGCTCGAGG ATCATCTGGG CGTTACCCTG TTTCACCGAA
ATCACCGCGG GGTCGAGCTG ACCGCGGCGG GGCGGCAGTT GCTGCCCGTG CTGACCGAGA CCTTTGCCCG GATCGCGCGC
GAGGCCGAAC AGATCTCGGC CATGACGCGG GATGTGCGGA TCATCTGCCC GCCGGCGCTG TCCATTCGCT GGCTGTTCCC
GCGTCTCGAG GAGTTTCAGG CCGCGCATCC TGACATCCGG GTGCGGCTGA CCACCGAGTT CTATGGCGCC AAGGGGTTTG
ACGATACCGA GCATGATCTG GGTGTTTCGG TCGAACATGT TTCCGGCCGA GGCGCCGGAA TCGCCAGCAT GCCGCTGTTT
CCGATGGTTC TGTCACCGGC CTGTTCGCCG GCGCTGCTGC GCCAGCGACC GCTAAGCGCT CCGGCCGATC TGGCGCGGAT
GACGCTGCTT CATGAATCCC CTCAGCGCAG GGACTGGGCG CATTGGTTGT CCAGCTTTGG CGTGCGCGGT GTTGATGCGG
GCAGCGGGCC GACCTTTCCG AACCTGGATA TGGCGGCACG GGCCGCAACG ATGGGCGCGG GTGTGGTCAT GGCGGATCTG
GCCCTGTGTC AGGAAGAGCT GCGCGCCGGA ACGCTTGTGC TTCCCTTTCC CGAGATGACC TGCACCACAC CGCAAGGAGG
GTATGTCCTG CTTGGTGCGC GCGCGCGGTG GGACGAGCCC CATCTGCGGG CGTTTCGCGA CTGGGCGGCC AGTAGCTCGG
CCGATCTTGT GGCGTGCATG GGCGCCTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7