Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0033
Type: CDS
Description: identified by match to protein family HMM PF00126; match to protein family HMM PF03466; NCBI:LysR family transcriptional regulator; IMG:transcriptional regulator; LysR family
Source: GenBank
Position: DSS3:32458..33366 (+ strand)
Length: 909
Dbxref: GI:56694961
  GeneID:3196462
Note: identified by match to protein family HMM PF00126; match to protein family HMM PF03466
  NCBI:LysR family transcriptional regulator
  IMG:transcriptional regulator
  LysR family
codon_start: 1
load_id: SPO0033.p01
parent_id: SPO0033.t01
product: transcriptional regulator, LysR family
protein_id: REF_tigr:SPO0033
  YP_165306.1
transl_table: 11
translation: MRLPPLNALRAFEAAARHNGYIAAAEELCVTRGAVSRHIKLLEDHLGVTLFHRNHRGVEL TAAGRQLLPVLTETFARIAREAEQISAMTRDVRIICPPALSIRWLFPRLEEFQAAHPDIR VRLTTEFYGAKGFDDTEHDLGVSVEHVSGRGAGIASMPLFPMVLSPACSPALLRQRPLSA PADLARMTLLHESPQRRDWAHWLSSFGVRGVDAGSGPTFPNLDMAARAATMGAGVVMADL ALCQEELRAGTLVLPFPEMTCTTPQGGYVLLGARARWDEPHLRAFRDWAASSSADLVACM GA
>SPO0033 class=Sequence position=DSS3:32458..33366 (+ strand)
ATGCGCTTGC CGCCGCTGAA CGCCCTGCGC GCTTTCGAAG CCGCCGCACG CCATAACGGC TATATCGCGG CCGCCGAAGA
GCTCTGCGTG ACCCGTGGCG CTGTCAGCCG TCATATCAAG CTGCTCGAGG ATCATCTGGG CGTTACCCTG TTTCACCGAA
ATCACCGCGG GGTCGAGCTG ACCGCGGCGG GGCGGCAGTT GCTGCCCGTG CTGACCGAGA CCTTTGCCCG GATCGCGCGC
GAGGCCGAAC AGATCTCGGC CATGACGCGG GATGTGCGGA TCATCTGCCC GCCGGCGCTG TCCATTCGCT GGCTGTTCCC
GCGTCTCGAG GAGTTTCAGG CCGCGCATCC TGACATCCGG GTGCGGCTGA CCACCGAGTT CTATGGCGCC AAGGGGTTTG
ACGATACCGA GCATGATCTG GGTGTTTCGG TCGAACATGT TTCCGGCCGA GGCGCCGGAA TCGCCAGCAT GCCGCTGTTT
CCGATGGTTC TGTCACCGGC CTGTTCGCCG GCGCTGCTGC GCCAGCGACC GCTAAGCGCT CCGGCCGATC TGGCGCGGAT
GACGCTGCTT CATGAATCCC CTCAGCGCAG GGACTGGGCG CATTGGTTGT CCAGCTTTGG CGTGCGCGGT GTTGATGCGG
GCAGCGGGCC GACCTTTCCG AACCTGGATA TGGCGGCACG GGCCGCAACG ATGGGCGCGG GTGTGGTCAT GGCGGATCTG
GCCCTGTGTC AGGAAGAGCT GCGCGCCGGA ACGCTTGTGC TTCCCTTTCC CGAGATGACC TGCACCACAC CGCAAGGAGG
GTATGTCCTG CTTGGTGCGC GCGCGCGGTG GGACGAGCCC CATCTGCGGG CGTTTCGCGA CTGGGCGGCC AGTAGCTCGG
CCGATCTTGT GGCGTGCATG GGCGCCTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7