Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0034
Type: CDS
Description: identified by similarity to GB:AAM48703.1; NCBI:nodulation protein NodH; IMG:LPS sulfotransferase NodH
Source: GenBank
Position: DSS3:33377..34816 (- strand)
Length: 1440
Dbxref: GI:56694962
  GeneID:3193208
Note: identified by similarity to GB:AAM48703.1
  NCBI:nodulation protein NodH
  IMG:LPS sulfotransferase NodH
codon_start: 1
load_id: SPO0034.p01
parent_id: SPO0034.t01
product: hypothetical protein
protein_id: REF_tigr:SPO0034
  YP_165307.1
transl_table: 11
translation: MSSPFDYFVVFAEMRTGSNFLEANLNALDGVACVGEAFNPHFIGYPNKTEILEVSQDMRD ADPQCLIDAVRDARGVLAGFRFFHDHDPRVLDLVLSDPRCAKIILTRNPLDSYVSWKIAK ETGQWKLTNIKRRKEAQARFDAEEFARHVEALQDFQVFLLNSLQRSGQTPFYVAYEDLQD LSVMNGLAQWLGVSARLEQLDDSLKRQNPSPVTSKVVNAGEMVEALSGLDRFNLTRTPNF EPRRGPAVPTYVTGAVTPLIYLPVRGGPEDEVRRWMADLDGVVDAALGTGLNQKQVRGWL KGNEGHRAFTVLRHPLARAHSAFCHRILNKGPGCFTKIRNTLRRQFSLPIPEGTPGLDYG RADHRAAFEAFLEFVRMNLAGQTAIRIDGSWCSQAQALSSFAEFVSPDLILREDEIATDL PSLARRFGHAEPPEPPRAAPDTPIPLSDIYDDALEALAADVYQRDYIVFGFGKWAGGQA
>SPO0034 class=Sequence position=DSS3:33377..34816 (- strand)
ATGAGCAGCC CTTTTGATTA CTTCGTCGTC TTCGCCGAGA TGCGGACAGG CTCCAACTTT CTCGAAGCGA ACCTGAACGC
GCTTGACGGG GTTGCCTGCG TGGGTGAGGC GTTCAACCCC CATTTCATCG GCTATCCCAA CAAGACCGAG ATACTGGAAG
TCAGCCAGGA CATGCGCGAT GCCGATCCGC AATGCCTGAT CGACGCGGTG CGGGACGCGC GCGGCGTGCT GGCGGGGTTC
CGGTTCTTTC ACGACCACGA TCCGCGCGTT CTGGACCTGG TCCTGTCCGA TCCGCGCTGC GCCAAGATCA TCCTGACCCG
CAATCCGCTT GACAGCTATG TCTCGTGGAA GATCGCCAAG GAAACCGGCC AGTGGAAGCT GACCAATATC AAGCGCCGAA
AGGAGGCACA GGCCCGCTTT GATGCCGAGG AATTTGCCCG CCATGTCGAG GCGTTGCAGG ATTTTCAGGT CTTCCTTCTC
AACAGCCTGC AACGCAGCGG CCAGACCCCG TTTTATGTCG CTTACGAGGA TCTGCAGGAC CTGTCGGTAA TGAACGGTCT
GGCGCAATGG CTGGGCGTCT CCGCGCGGCT GGAACAACTG GATGACAGCC TGAAACGGCA GAACCCCAGC CCGGTTACCT
CCAAGGTGGT GAACGCGGGC GAGATGGTCG AGGCGCTCAG CGGGCTCGAT CGGTTCAACC TGACCCGAAC CCCCAATTTC
GAACCGCGCC GCGGCCCCGC CGTGCCGACC TATGTCACCG GGGCGGTGAC GCCGCTGATC TATCTGCCGG TGCGCGGCGG
CCCCGAGGAT GAGGTGCGCC GCTGGATGGC CGATCTCGAC GGGGTGGTCG ATGCGGCGCT GGGCACCGGG CTGAACCAGA
AACAGGTGCG CGGCTGGCTG AAAGGAAACG AGGGTCACCG CGCGTTTACT GTGCTGCGCC ACCCGCTGGC ACGCGCGCAT
TCCGCATTCT GCCACCGTAT CCTGAACAAG GGACCCGGCT GTTTCACCAA GATCCGGAAC ACCCTGCGCC GGCAGTTCAG
CCTGCCCATT CCCGAAGGCA CCCCGGGGCT GGATTACGGC CGTGCCGATC ACCGTGCTGC GTTCGAGGCG TTTCTGGAAT
TTGTCCGCAT GAACCTGGCC GGGCAGACCG CAATCCGCAT CGACGGGTCG TGGTGCAGCC AGGCGCAGGC CTTGAGCAGC
TTTGCGGAAT TCGTCAGCCC CGACCTGATC CTGCGCGAGG ACGAAATCGC CACCGATCTG CCGTCGCTGG CCCGCCGCTT
TGGCCATGCC GAACCGCCCG AGCCGCCGCG CGCCGCCCCC GATACCCCGA TCCCGCTGAG TGATATCTAT GACGACGCGC
TCGAGGCGCT GGCCGCCGAT GTCTATCAGC GCGACTATAT CGTGTTCGGG TTCGGGAAAT GGGCAGGCGG ACAGGCATAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7