Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0035
Type: gene
Description:
Source: GenBank
Position: DSS3:34823..36502 (- strand)
Length: 1680
Dbxref: GeneID:3193855
load_id: SPO0035
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:34823..36502 (- strand)
Length: 1680
load_id: SPO0035.t01
parent_id: SPO0035
Parts:
Type: CDS
Description: identified by match to protein family HMM PF02485; NCBI:glycosyl transferase; IMG:Core-2/I-Branching enzyme
Source: GenBank
Position: DSS3:34823..36502 (- strand)
Length: 1680
Dbxref: GI:56694963
  GeneID:3193855
Note: identified by match to protein family HMM PF02485
  NCBI:glycosyl transferase
  IMG:Core-2/I-Branching enzyme
codon_start: 1
load_id: SPO0035.p01
parent_id: SPO0035.t01
product: core-2/I-branching enzyme family protein
protein_id: REF_tigr:SPO0035
  YP_165308.1
transl_table: 11
translation: MLVHTALDRAQQVAQHWTASGCPVVIHVDRKVSRKTFKAFHDACVKDPLIRFSTRHRCEW GTWGIVAASQAASEQMLAEFADVRHVYLASGSCLPLRPVQELIDYLAARPRTDFIESATT ADVPWTVGGLDQERFTLRFPFSWKKHRYLFDKYVNLQRRLGFKRRIPAGLVPHMGSQWWC LTRHTLSAILEDPERTVYDAYFRKVWIPDESYFQTLARQFSANIESRSLTLSKFDFQGKP HIFYDDHLQLLRRSDCFVARKIWPRAERLYQAFLTDQAGAMKRTEPNPGKIDRIFAKAVE RRTRGRDGLYMQSRFPRHGNENGLTSNPYSVFQGFTELFEDFEPWLAKATGTRVHGHLFG PERAEFAGGERLVNGALSDCALLRDYNPTSFLTSLIWNTRGERQCFQFGPADNQKIDWLL ARDPNAQISVITGAWAVPLFKSNRNFADLRKEAARLQRIESKHLEILRSVWTKARVRIWT MAEFVEAPMEPIQTIVDEIGQSSPRRLTEAPTMVDLTGFGQFLQNLKNQGMHPYLMGDFP VEPAPINNPKPTRKPYLVR
Type: exon
Description:
Source: GenBank
Position: DSS3:34823..36502 (- strand)
Length: 1680
parent_id: SPO0035.t01
> class=Sequence position=DSS3:34823..36502 (- strand)
ATGCTGGTTC ACACCGCGCT CGACCGGGCG CAGCAGGTGG CGCAGCATTG GACCGCCTCG GGCTGTCCTG TTGTGATCCA
TGTCGACCGA AAGGTGTCCC GCAAGACGTT CAAGGCGTTT CACGATGCCT GCGTCAAGGA CCCGCTGATC CGGTTCAGCA
CCCGCCACCG CTGCGAATGG GGCACCTGGG GGATCGTCGC CGCCTCGCAG GCCGCGTCCG AGCAGATGCT GGCCGAATTC
GCCGATGTGC GCCATGTCTA CCTTGCCTCC GGTTCCTGCC TGCCGCTGCG TCCGGTGCAA GAGCTGATCG ACTATCTCGC
CGCCCGGCCG CGCACCGATT TCATCGAAAG CGCCACCACC GCAGATGTGC CCTGGACCGT GGGCGGGCTG GATCAGGAAC
GCTTTACCCT GCGCTTTCCC TTCTCGTGGA AAAAGCACCG CTATCTGTTC GACAAATACG TCAATCTGCA ACGGCGCCTG
GGGTTCAAAC GCAGGATACC TGCCGGGCTG GTGCCGCATA TGGGAAGCCA GTGGTGGTGC CTGACGCGGC ACACCCTCTC
GGCTATCCTC GAGGACCCCG AGCGCACCGT CTATGACGCG TATTTCCGCA AGGTCTGGAT CCCGGATGAA AGCTATTTCC
AGACTCTGGC GCGGCAGTTC TCGGCCAATA TCGAAAGCCG CTCGCTGACG TTGAGCAAGT TCGATTTCCA GGGCAAACCG
CATATCTTCT ACGACGATCA CCTGCAATTG CTGCGGCGGT CCGACTGTTT CGTCGCCCGC AAGATATGGC CCCGGGCGGA
ACGGCTGTAT CAGGCCTTTC TGACCGATCA GGCCGGCGCC ATGAAACGGA CCGAGCCGAA CCCGGGCAAG ATCGACCGCA
TCTTTGCCAA GGCGGTCGAG CGGCGGACGC GGGGCCGCGA CGGCCTGTAT ATGCAAAGCC GCTTTCCCCG CCACGGCAAC
GAGAACGGCC TGACCTCGAA CCCCTATTCC GTGTTCCAGG GCTTTACCGA ACTGTTCGAG GATTTCGAGC CCTGGCTGGC
CAAGGCCACC GGCACCCGTG TGCATGGGCA TCTCTTTGGC CCCGAGAGGG CCGAATTCGC CGGCGGCGAG CGGCTGGTCA
ACGGCGCGCT CAGCGATTGC GCCCTGCTGC GCGACTATAA CCCGACCAGT TTCCTGACCT CGCTGATCTG GAACACAAGG
GGCGAGCGGC AGTGTTTCCA GTTCGGCCCC GCCGACAATC AGAAAATCGA CTGGCTGCTG GCGCGCGACC CCAACGCCCA
GATTTCGGTC ATCACCGGCG CCTGGGCGGT GCCGCTGTTC AAATCGAACC GCAACTTCGC CGACCTGCGC AAAGAGGCCG
CGCGCCTGCA ACGGATCGAA AGCAAGCATC TGGAAATCCT GCGTTCGGTC TGGACCAAGG CGCGGGTGCG GATCTGGACG
ATGGCCGAAT TCGTCGAGGC GCCTATGGAG CCGATCCAGA CCATCGTGGA CGAGATCGGG CAATCAAGCC CGCGCCGCCT
GACCGAAGCG CCAACCATGG TGGATCTGAC CGGCTTCGGC CAGTTCCTGC AGAACCTCAA GAACCAGGGC ATGCACCCCT
ATCTGATGGG GGATTTCCCG GTCGAACCGG CCCCGATCAA CAACCCCAAA CCGACACGCA AACCCTATCT GGTGCGATAA
>SPO0035 class=Sequence position=DSS3:34823..36502 (- strand)
ATGCTGGTTC ACACCGCGCT CGACCGGGCG CAGCAGGTGG CGCAGCATTG GACCGCCTCG GGCTGTCCTG TTGTGATCCA
TGTCGACCGA AAGGTGTCCC GCAAGACGTT CAAGGCGTTT CACGATGCCT GCGTCAAGGA CCCGCTGATC CGGTTCAGCA
CCCGCCACCG CTGCGAATGG GGCACCTGGG GGATCGTCGC CGCCTCGCAG GCCGCGTCCG AGCAGATGCT GGCCGAATTC
GCCGATGTGC GCCATGTCTA CCTTGCCTCC GGTTCCTGCC TGCCGCTGCG TCCGGTGCAA GAGCTGATCG ACTATCTCGC
CGCCCGGCCG CGCACCGATT TCATCGAAAG CGCCACCACC GCAGATGTGC CCTGGACCGT GGGCGGGCTG GATCAGGAAC
GCTTTACCCT GCGCTTTCCC TTCTCGTGGA AAAAGCACCG CTATCTGTTC GACAAATACG TCAATCTGCA ACGGCGCCTG
GGGTTCAAAC GCAGGATACC TGCCGGGCTG GTGCCGCATA TGGGAAGCCA GTGGTGGTGC CTGACGCGGC ACACCCTCTC
GGCTATCCTC GAGGACCCCG AGCGCACCGT CTATGACGCG TATTTCCGCA AGGTCTGGAT CCCGGATGAA AGCTATTTCC
AGACTCTGGC GCGGCAGTTC TCGGCCAATA TCGAAAGCCG CTCGCTGACG TTGAGCAAGT TCGATTTCCA GGGCAAACCG
CATATCTTCT ACGACGATCA CCTGCAATTG CTGCGGCGGT CCGACTGTTT CGTCGCCCGC AAGATATGGC CCCGGGCGGA
ACGGCTGTAT CAGGCCTTTC TGACCGATCA GGCCGGCGCC ATGAAACGGA CCGAGCCGAA CCCGGGCAAG ATCGACCGCA
TCTTTGCCAA GGCGGTCGAG CGGCGGACGC GGGGCCGCGA CGGCCTGTAT ATGCAAAGCC GCTTTCCCCG CCACGGCAAC
GAGAACGGCC TGACCTCGAA CCCCTATTCC GTGTTCCAGG GCTTTACCGA ACTGTTCGAG GATTTCGAGC CCTGGCTGGC
CAAGGCCACC GGCACCCGTG TGCATGGGCA TCTCTTTGGC CCCGAGAGGG CCGAATTCGC CGGCGGCGAG CGGCTGGTCA
ACGGCGCGCT CAGCGATTGC GCCCTGCTGC GCGACTATAA CCCGACCAGT TTCCTGACCT CGCTGATCTG GAACACAAGG
GGCGAGCGGC AGTGTTTCCA GTTCGGCCCC GCCGACAATC AGAAAATCGA CTGGCTGCTG GCGCGCGACC CCAACGCCCA
GATTTCGGTC ATCACCGGCG CCTGGGCGGT GCCGCTGTTC AAATCGAACC GCAACTTCGC CGACCTGCGC AAAGAGGCCG
CGCGCCTGCA ACGGATCGAA AGCAAGCATC TGGAAATCCT GCGTTCGGTC TGGACCAAGG CGCGGGTGCG GATCTGGACG
ATGGCCGAAT TCGTCGAGGC GCCTATGGAG CCGATCCAGA CCATCGTGGA CGAGATCGGG CAATCAAGCC CGCGCCGCCT
GACCGAAGCG CCAACCATGG TGGATCTGAC CGGCTTCGGC CAGTTCCTGC AGAACCTCAA GAACCAGGGC ATGCACCCCT
ATCTGATGGG GGATTTCCCG GTCGAACCGG CCCCGATCAA CAACCCCAAA CCGACACGCA AACCCTATCT GGTGCGATAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7