Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0036
Type: CDS
Description: identified by similarity to GB:CAC46616.1; NCBI:glycosyl transferase family 2; IMG:Glycosyl transferase family 2
Source: GenBank
Position: DSS3:36520..37542 (- strand)
Length: 1023
Dbxref: GI:56694964
  GeneID:3195595
Note: identified by similarity to GB:CAC46616.1
  NCBI:glycosyl transferase family 2
  IMG:Glycosyl transferase family 2
codon_start: 1
load_id: SPO0036.p01
parent_id: SPO0036.t01
product: hypothetical protein
protein_id: REF_tigr:SPO0036
  YP_165309.1
transl_table: 11
translation: MDSSVSLWDSYRMRVRRKRRLLRCIRKSRELRAVQNNTAAIRPSDVLLVSTVRNEKIRLP YFLRYYRELGIDHFLIVDNDSTDGTLDYLGGQSDVSVWHTTHSYKSATFGVDWMNWLKRS YAHDHWVLVVDPDEFFIYPFCDTRPIQALTDWLDNSSIRSFSAMLIDVYPKGRIDDVPYV EGQNPLEIANWFDSGNYMIKKNPEYGNLWIQGGPRSRVFFPDNPKKAPALNKTPLVKWNR RYAYVSSTHALLPRGLNQVYDEWGGEKASGALLHTKFLDTFTVKAAEELTRRQHYSNSVE YKAYADRVQDQPDLWCKWSEKYINWRQLEILGLMSKGNWA
>SPO0036 class=Sequence position=DSS3:36520..37542 (- strand)
GTGGATAGCA GCGTGAGCCT TTGGGACTCC TATCGGATGA GAGTGCGGCG CAAGCGCCGT CTTTTGCGTT GCATACGCAA
GTCCCGGGAA TTGCGCGCCG TTCAGAACAA TACCGCCGCA ATTCGCCCAA GCGACGTGCT GTTGGTCAGC ACCGTCCGGA
ACGAGAAAAT CCGCCTGCCC TATTTCCTGC GCTATTACCG CGAGCTGGGG ATCGACCATT TCCTGATCGT GGACAATGAC
AGCACCGATG GCACGCTCGA TTATCTCGGC GGGCAATCTG ACGTATCGGT CTGGCACACC ACGCACAGCT ACAAATCGGC
CACGTTCGGC GTCGATTGGA TGAATTGGCT GAAACGCAGC TATGCCCATG ACCATTGGGT GCTGGTGGTC GACCCGGACG
AGTTCTTTAT CTATCCGTTC TGCGATACCC GCCCGATCCA GGCGCTGACT GACTGGCTCG ACAATTCCTC GATCCGGTCT
TTCAGCGCGA TGCTGATCGA CGTTTATCCC AAGGGGCGGA TTGACGACGT TCCCTATGTC GAAGGGCAGA ATCCGCTGGA
GATCGCCAAT TGGTTCGACA GCGGCAATTA CATGATCAAG AAAAACCCCG AATACGGCAA TCTGTGGATC CAGGGCGGGC
CGCGCAGCCG GGTGTTCTTT CCCGACAACC CCAAGAAGGC CCCCGCGCTG AACAAGACCC CGCTGGTGAA ATGGAACCGG
CGGTATGCCT ATGTCAGCTC GACCCACGCC TTGCTGCCGC GCGGCCTTAA TCAGGTCTAT GACGAATGGG GCGGCGAAAA
GGCCAGCGGC GCCCTGCTGC ATACCAAGTT TCTGGATACG TTCACCGTCA AGGCGGCCGA GGAACTGACC CGCCGCCAGC
ACTATTCCAA CTCGGTTGAA TACAAGGCCT ATGCGGACCG CGTGCAGGAC CAGCCGGACC TGTGGTGCAA ATGGTCCGAG
AAATACATCA ACTGGCGCCA GCTCGAGATC CTGGGCCTCA TGTCCAAGGG GAACTGGGCA TGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7