Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0037
Type: CDS
Description: identified by similarity to GB:CAC46616.1; NCBI:hypothetical protein; IMG:Glycosyl transferase family 2
Source: GenBank
Position: DSS3:37703..38752 (- strand)
Length: 1050
Dbxref: GI:56694965
  GeneID:3195218
Note: identified by similarity to GB:CAC46616.1
  NCBI:hypothetical protein
  IMG:Glycosyl transferase family 2
codon_start: 1
load_id: SPO0037.p01
parent_id: SPO0037.t01
product: hypothetical protein
protein_id: REF_tigr:SPO0037
  YP_165310.1
transl_table: 11
translation: MTSSPAPPLSPIGWADAYRLRWKRQRLLWRAFRSRRALTALADRTAAIRPGQVLAVTTLR NEVLRLPWFLDYYRTLGVGHFLMVDNGSDDGSVEMLAAQPDVSLWQTGASYRDARFGLDW MTWLQIRHAHGHWCLMVDVDELLIYAHHDRRDLHALTGWLERQGRNCFGAHMLDLYPKGP VAAQTHAPGEDPLDILHWFDAAPYRAQRQQPLGNLWVQGGARERMFFADDPRRSPTLNKI PLIRWDRRYAYVNSCHSALPRQLNAVYGGPGDSAPSGVLLHTKFLPDIVSRSAEEKTRQQ HFHTPADFDHYYDDLTASPDFWTPSSTRFTGWRQLHDLGLLSPGGWEEG
>SPO0037 class=Sequence position=DSS3:37703..38752 (- strand)
ATGACCAGCA GCCCCGCACC GCCGCTATCG CCGATCGGAT GGGCCGATGC CTATCGGTTG CGGTGGAAAC GGCAGCGGCT
GCTGTGGCGC GCGTTCCGCA GCCGACGCGC GCTGACCGCA CTGGCCGACC GCACGGCGGC GATCCGCCCG GGTCAGGTTC
TGGCCGTCAC GACGCTCAGG AACGAGGTGC TGCGCCTGCC CTGGTTCCTG GACTATTACC GCACCCTAGG CGTCGGCCAC
TTTCTGATGG TCGACAACGG CAGCGACGAT GGCAGCGTCG AGATGCTGGC CGCGCAGCCC GATGTCTCGC TCTGGCAGAC
CGGGGCCAGC TATCGCGACG CGCGCTTTGG GCTGGATTGG ATGACCTGGC TGCAAATACG CCACGCGCAT GGGCATTGGT
GCCTGATGGT CGATGTGGAC GAGTTGCTGA TCTATGCCCA TCACGACCGC CGCGACCTGC ATGCGCTGAC CGGCTGGCTG
GAGCGGCAGG GGCGCAACTG CTTTGGCGCA CATATGCTGG ACCTTTACCC CAAGGGGCCG GTCGCCGCGC AGACCCATGC
GCCGGGCGAG GATCCGTTGG ATATCCTGCA CTGGTTCGAC GCCGCCCCCT ATCGCGCCCA GCGCCAGCAA CCGCTGGGCA
ATCTGTGGGT GCAGGGCGGT GCGCGCGAAC GGATGTTCTT TGCCGATGAT CCGCGCCGCT CACCGACGCT GAACAAGATA
CCGCTGATCC GCTGGGACCG GCGCTATGCC TATGTGAACT CTTGCCATTC CGCCCTGCCC CGGCAGCTGA ACGCGGTTTA
TGGCGGGCCG GGCGACAGTG CGCCCTCGGG GGTGCTGCTG CACACCAAGT TCCTGCCCGA CATTGTTTCC AGATCGGCCG
AAGAGAAGAC CCGCCAACAG CATTTTCACA CCCCCGCCGA TTTCGACCAT TACTATGACG ACCTGACCGC CTCGCCCGAT
TTCTGGACTC CCTCCTCGAC CCGGTTCACG GGTTGGCGGC AATTGCACGA TCTCGGGCTT CTTTCACCCG GAGGTTGGGA
GGAAGGTTAA 

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7