Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0040
Type: gene
Description:
Source: Genbank
Position: CP000031.2:40483..41304 (+ strand)
Length: 822
gbkey: Gene
gene: SPO0040
gene_biotype: protein_coding
load_id: gene-SPO0040
locus_tag: SPO0040
Parts:
Type: CDS
Description:
Source: Genbank
Position: CP000031.2:40483..41304 (+ strand)
Length: 822
"ID: cds-AAV93371.1
Dbxref: NCBI_GP:AAV93371.1
IMG: SPO0040: ABC transporter
  permease protein
RefSeq: SPO_RS00200: ABC transporter permease"
gbkey: CDS
gene: SPO0040
locus_tag: SPO0040
parent_id: gene-SPO0040
product: ABC transporter
  permease protein
protein_id: AAV93371.1
transl_table: 11
translation: MFRYRQHKSLLSGAITMAELIFHNVVRGVRQGHSNAYAALGKNMMQILVFVLVFYMMFSM LGLRGSAIRGDFLLYIMSGIFLFMVHIKTVGAVAGAEGPNSAMMKHAPMNTIIAILSAAL GSLYTQLLTLFLILFGYHVAFKPVEIADPAGAFGMLMLAWFTGCAVGLVFLSIKPWAPML VGVMTTLYQRANMIASGKMFVANTLPGYMLAMFDWNPLFHAIDQCRGFVFRNYFPHNSNW HYSLWLGIILIMIGLMGEFYTRRHVSASWYARR
>SPO0040 class=Sequence position=CP000031.2:40483..41304 (+ strand)
GTGTTTCGAT ATCGGCAGCA CAAATCCCTA TTGAGCGGCG CCATCACCAT GGCCGAGCTC ATCTTTCACA ACGTGGTGCG
CGGCGTCCGT CAGGGCCATT CCAATGCCTA TGCGGCGTTG GGCAAGAACA TGATGCAGAT CCTGGTCTTT GTGCTGGTGT
TCTACATGAT GTTTTCGATG CTGGGGCTGC GCGGTTCGGC GATCCGGGGC GATTTCCTGC TCTACATCAT GTCGGGCATT
TTCCTGTTCA TGGTGCACAT CAAGACGGTG GGTGCGGTTG CCGGGGCCGA AGGGCCCAAC AGCGCGATGA TGAAACATGC
GCCCATGAAC ACGATCATTG CCATCCTCTC GGCGGCTTTG GGGTCGCTCT ATACCCAGCT GCTGACGCTG TTCCTGATTC
TCTTTGGCTA TCATGTCGCT TTCAAGCCGG TCGAGATCGC CGATCCTGCC GGTGCGTTCG GCATGTTGAT GCTGGCCTGG
TTCACGGGCT GTGCGGTCGG GTTGGTGTTC CTGTCGATCA AGCCCTGGGC GCCGATGCTG GTGGGGGTGA TGACCACGCT
TTACCAGCGC GCCAACATGA TCGCCTCGGG CAAGATGTTC GTTGCCAATA CCTTGCCGGG TTACATGCTG GCCATGTTCG
ACTGGAACCC GCTGTTTCAC GCCATCGACC AATGCCGTGG CTTCGTGTTT CGCAACTATT TCCCGCATAA CAGCAACTGG
CACTATTCGC TGTGGCTGGG GATCATCCTG ATCATGATCG GGCTGATGGG CGAATTCTAT ACCCGCCGGC ATGTCTCGGC
CAGCTGGTAC GCGCGGCGAT GA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7