Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0040
Type: gene
Description:
Source: GenBank
Position: DSS3:40483..41304 (+ strand)
Length: 822
Dbxref: GeneID:3195714
load_id: SPO0040
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:40483..41304 (+ strand)
Length: 822
load_id: SPO0040.t01
parent_id: SPO0040
Parts:
Type: CDS
Description: NCBI:ABC transporter permease; IMG:ABC-type polysaccharide/polyol phosphate export permease
Source: GenBank
Position: DSS3:40483..41304 (+ strand)
Length: 822
Dbxref: GI:56694968
  GeneID:3195714
Note: NCBI:ABC transporter permease
  IMG:ABC-type polysaccharide/polyol phosphate export permease
codon_start: 1
load_id: SPO0040.p01
parent_id: SPO0040.t01
product: ABC transporter, permease protein
protein_id: REF_tigr:SPO0040
  YP_165313.1
transl_table: 11
translation: MFRYRQHKSLLSGAITMAELIFHNVVRGVRQGHSNAYAALGKNMMQILVFVLVFYMMFSM LGLRGSAIRGDFLLYIMSGIFLFMVHIKTVGAVAGAEGPNSAMMKHAPMNTIIAILSAAL GSLYTQLLTLFLILFGYHVAFKPVEIADPAGAFGMLMLAWFTGCAVGLVFLSIKPWAPML VGVMTTLYQRANMIASGKMFVANTLPGYMLAMFDWNPLFHAIDQCRGFVFRNYFPHNSNW HYSLWLGIILIMIGLMGEFYTRRHVSASWYARR
Type: exon
Description:
Source: GenBank
Position: DSS3:40483..41304 (+ strand)
Length: 822
parent_id: SPO0040.t01
> class=Sequence position=DSS3:40483..41304 (+ strand)
GTGTTTCGAT ATCGGCAGCA CAAATCCCTA TTGAGCGGCG CCATCACCAT GGCCGAGCTC ATCTTTCACA ACGTGGTGCG
CGGCGTCCGT CAGGGCCATT CCAATGCCTA TGCGGCGTTG GGCAAGAACA TGATGCAGAT CCTGGTCTTT GTGCTGGTGT
TCTACATGAT GTTTTCGATG CTGGGGCTGC GCGGTTCGGC GATCCGGGGC GATTTCCTGC TCTACATCAT GTCGGGCATT
TTCCTGTTCA TGGTGCACAT CAAGACGGTG GGTGCGGTTG CCGGGGCCGA AGGGCCCAAC AGCGCGATGA TGAAACATGC
GCCCATGAAC ACGATCATTG CCATCCTCTC GGCGGCTTTG GGGTCGCTCT ATACCCAGCT GCTGACGCTG TTCCTGATTC
TCTTTGGCTA TCATGTCGCT TTCAAGCCGG TCGAGATCGC CGATCCTGCC GGTGCGTTCG GCATGTTGAT GCTGGCCTGG
TTCACGGGCT GTGCGGTCGG GTTGGTGTTC CTGTCGATCA AGCCCTGGGC GCCGATGCTG GTGGGGGTGA TGACCACGCT
TTACCAGCGC GCCAACATGA TCGCCTCGGG CAAGATGTTC GTTGCCAATA CCTTGCCGGG TTACATGCTG GCCATGTTCG
ACTGGAACCC GCTGTTTCAC GCCATCGACC AATGCCGTGG CTTCGTGTTT CGCAACTATT TCCCGCATAA CAGCAACTGG
CACTATTCGC TGTGGCTGGG GATCATCCTG ATCATGATCG GGCTGATGGG CGAATTCTAT ACCCGCCGGC ATGTCTCGGC
CAGCTGGTAC GCGCGGCGAT GA
>SPO0040 class=Sequence position=DSS3:40483..41304 (+ strand)
GTGTTTCGAT ATCGGCAGCA CAAATCCCTA TTGAGCGGCG CCATCACCAT GGCCGAGCTC ATCTTTCACA ACGTGGTGCG
CGGCGTCCGT CAGGGCCATT CCAATGCCTA TGCGGCGTTG GGCAAGAACA TGATGCAGAT CCTGGTCTTT GTGCTGGTGT
TCTACATGAT GTTTTCGATG CTGGGGCTGC GCGGTTCGGC GATCCGGGGC GATTTCCTGC TCTACATCAT GTCGGGCATT
TTCCTGTTCA TGGTGCACAT CAAGACGGTG GGTGCGGTTG CCGGGGCCGA AGGGCCCAAC AGCGCGATGA TGAAACATGC
GCCCATGAAC ACGATCATTG CCATCCTCTC GGCGGCTTTG GGGTCGCTCT ATACCCAGCT GCTGACGCTG TTCCTGATTC
TCTTTGGCTA TCATGTCGCT TTCAAGCCGG TCGAGATCGC CGATCCTGCC GGTGCGTTCG GCATGTTGAT GCTGGCCTGG
TTCACGGGCT GTGCGGTCGG GTTGGTGTTC CTGTCGATCA AGCCCTGGGC GCCGATGCTG GTGGGGGTGA TGACCACGCT
TTACCAGCGC GCCAACATGA TCGCCTCGGG CAAGATGTTC GTTGCCAATA CCTTGCCGGG TTACATGCTG GCCATGTTCG
ACTGGAACCC GCTGTTTCAC GCCATCGACC AATGCCGTGG CTTCGTGTTT CGCAACTATT TCCCGCATAA CAGCAACTGG
CACTATTCGC TGTGGCTGGG GATCATCCTG ATCATGATCG GGCTGATGGG CGAATTCTAT ACCCGCCGGC ATGTCTCGGC
CAGCTGGTAC GCGCGGCGAT GA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7