Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0041
Type: gene
Description:
Source: Genbank
Position: CP000031.2:41301..41885 (+ strand)
Length: 585
gbkey: Gene
gene: SPO0041
gene_biotype: protein_coding
load_id: gene-SPO0041
locus_tag: SPO0041
Parts:
Type: CDS
Description: identified by similarity to PIR:E82361
Source: Genbank
Position: CP000031.2:41301..41885 (+ strand)
Length: 585
Dbxref: NCBI_GP:AAV93372.1
IMG:
Note: identified by similarity to PIR:E82361
RefSeq: SPO_RS22085: SH3 domain-containing protein
gbkey: CDS
gene: SPO0041
load_id: cds-AAV93372.1
locus_tag: SPO0041
parent_id: gene-SPO0041
product: hypothetical protein
protein_id: AAV93372.1
transl_table: 11
translation: MRWLVALLLVLAAPLAADPVPALFDVTGVAADDVLNVREDPSAGSEVIGTLAPDAVGVEV VDLTFGGDWGRVNVNETSGWVSMRYMQQQPESDGVWMTPRFTCSGTEPFWSLTVEQGVGA RFQIMGEAEQALPAGLLRPGAGLIDRFALPLGHNLAILRQMQCHDGMSDRAYGLDVGLML NGSLYAGCCTLLPN
>SPO0041 class=Sequence position=CP000031.2:41301..41885 (+ strand)
ATGAGGTGGC TTGTCGCCCT GCTGCTGGTG CTTGCCGCAC CGCTTGCCGC CGATCCGGTG CCCGCATTGT TCGATGTGAC
CGGGGTTGCC GCCGATGATG TGCTGAACGT GCGCGAGGAC CCTTCGGCCG GGTCCGAAGT GATCGGCACG CTGGCGCCCG
ATGCGGTCGG GGTCGAGGTT GTCGACCTGA CCTTTGGCGG CGACTGGGGC CGGGTGAACG TGAACGAGAC AAGCGGTTGG
GTCTCGATGC GCTACATGCA GCAGCAGCCC GAGTCCGACG GGGTCTGGAT GACCCCGCGT TTCACCTGTT CCGGGACCGA
GCCGTTTTGG TCGCTGACCG TCGAACAGGG GGTCGGGGCG CGGTTCCAGA TCATGGGCGA GGCAGAGCAG GCTCTGCCGG
CCGGTCTGCT CAGACCCGGG GCGGGTTTGA TCGACCGCTT TGCCCTGCCG CTGGGCCATA ACCTCGCCAT CCTGCGGCAG
ATGCAGTGCC ATGACGGCAT GTCCGACCGG GCCTATGGGC TGGATGTGGG CCTGATGCTG AACGGATCGC TTTACGCCGG
CTGCTGCACG CTGTTGCCGA ACTAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7