Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0041
Type: CDS
Description: identified by similarity to PIR:E82361; NCBI:; IMG:SH3 domain-containing protein
Source: GenBank
Position: DSS3:41301..41885 (+ strand)
Length: 585
Dbxref: GI:56694969
  GeneID:3192766
Note: identified by similarity to PIR:E82361
  NCBI:
  IMG:SH3 domain-containing protein
codon_start: 1
load_id: SPO0041.p01
parent_id: SPO0041.t01
product: hypothetical protein
protein_id: REF_tigr:SPO0041
  YP_165314.1
transl_table: 11
translation: MRWLVALLLVLAAPLAADPVPALFDVTGVAADDVLNVREDPSAGSEVIGTLAPDAVGVEV VDLTFGGDWGRVNVNETSGWVSMRYMQQQPESDGVWMTPRFTCSGTEPFWSLTVEQGVGA RFQIMGEAEQALPAGLLRPGAGLIDRFALPLGHNLAILRQMQCHDGMSDRAYGLDVGLML NGSLYAGCCTLLPN
>SPO0041 class=Sequence position=DSS3:41301..41885 (+ strand)
ATGAGGTGGC TTGTCGCCCT GCTGCTGGTG CTTGCCGCAC CGCTTGCCGC CGATCCGGTG CCCGCATTGT TCGATGTGAC
CGGGGTTGCC GCCGATGATG TGCTGAACGT GCGCGAGGAC CCTTCGGCCG GGTCCGAAGT GATCGGCACG CTGGCGCCCG
ATGCGGTCGG GGTCGAGGTT GTCGACCTGA CCTTTGGCGG CGACTGGGGC CGGGTGAACG TGAACGAGAC AAGCGGTTGG
GTCTCGATGC GCTACATGCA GCAGCAGCCC GAGTCCGACG GGGTCTGGAT GACCCCGCGT TTCACCTGTT CCGGGACCGA
GCCGTTTTGG TCGCTGACCG TCGAACAGGG GGTCGGGGCG CGGTTCCAGA TCATGGGCGA GGCAGAGCAG GCTCTGCCGG
CCGGTCTGCT CAGACCCGGG GCGGGTTTGA TCGACCGCTT TGCCCTGCCG CTGGGCCATA ACCTCGCCAT CCTGCGGCAG
ATGCAGTGCC ATGACGGCAT GTCCGACCGG GCCTATGGGC TGGATGTGGG CCTGATGCTG AACGGATCGC TTTACGCCGG
CTGCTGCACG CTGTTGCCGA ACTAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7