Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0042
Type: gene
Description:
Source: Genbank
Position: CP000031.2:41882..42478 (- strand)
Length: 597
gbkey: Gene
gene: SPO0042
gene_biotype: protein_coding
load_id: gene-SPO0042
locus_tag: SPO0042
Parts:
Type: CDS
Description: identified by similarity to SP:P05050; match to protein family HMM PF03171
Source: Genbank
Position: CP000031.2:41882..42478 (- strand)
Length: 597
"ID: cds-AAV93373.1
Dbxref: NCBI_GP:AAV93373.1
IMG: SPO0042: DNA-N1-methyladenine dioxygenase (EC 1.14.11.-)
Note: identified by similarity to SP:P05050; match to protein family HMM PF03171
RefSeq: SPO_RS00210: alpha-ketoglutarate-dependent dioxygenase AlkB"
gbkey: CDS
gene: SPO0042
locus_tag: SPO0042
parent_id: gene-SPO0042
product: alkylated DNA repair protein
  putative
protein_id: AAV93373.1
transl_table: 11
translation: MLNLRGVEIRKGALDGPAQARLIEALRPVLKAAPLFTPTMPNGKPLSVRMTSAGSLGWVT DKGGYRYQPTHPKGMAWPAIPPEVLDLWHGVTGQDRAPDCCLINYYGEGARMGLHQDRDE ADLTWPVVSLSLGDDALFRIGNTSRGGKTESVWLNSGDVVVMGGPARLIYHGIDRIRFGS SRLLPKGGRLNLTLRVAG
>SPO0042 class=Sequence position=CP000031.2:41882..42478 (- strand)
ATGTTGAACC TGCGTGGTGT CGAGATTCGC AAAGGCGCGC TCGACGGGCC GGCCCAGGCA CGGCTGATCG AGGCATTGCG
CCCGGTTCTG AAGGCCGCGC CGCTGTTCAC CCCCACCATG CCGAACGGCA AGCCGCTGTC GGTGCGGATG ACCTCGGCAG
GGTCGCTGGG ATGGGTGACC GACAAGGGCG GCTATCGCTA TCAGCCGACC CATCCGAAGG GCATGGCCTG GCCCGCGATT
CCGCCCGAGG TGCTGGATCT GTGGCACGGG GTCACGGGTC AGGATCGCGC GCCCGATTGC TGCCTGATCA ACTATTATGG
CGAGGGCGCC CGGATGGGCC TGCACCAGGA TCGCGACGAA GCCGATCTGA CCTGGCCCGT GGTGTCGCTG TCACTGGGCG
ATGACGCCCT GTTTCGCATC GGCAATACCA GCCGGGGAGG CAAGACGGAA TCGGTCTGGC TGAACTCGGG CGATGTGGTG
GTGATGGGCG GACCGGCGCG GCTGATCTAT CACGGGATCG ACCGGATCCG GTTCGGCTCG TCCCGGCTGT TGCCCAAAGG
CGGGCGGCTG AACCTGACGC TGCGGGTTGC GGGCTAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7