Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0042
Type: CDS
Description: identified by similarity to SP:P05050; match to protein family HMM PF03171; NCBI:dioxygenase; IMG:DNA-N1-methyladenine dioxygenase
Source: GenBank
Position: DSS3:41882..42478 (- strand)
Length: 597
Dbxref: GI:56694970
  GeneID:3194568
Note: identified by similarity to SP:P05050; match to protein family HMM PF03171
  NCBI:dioxygenase
  IMG:DNA-N1-methyladenine dioxygenase
codon_start: 1
load_id: SPO0042.p01
parent_id: SPO0042.t01
product: alkylated DNA repair protein, putative
protein_id: REF_tigr:SPO0042
  YP_165315.1
transl_table: 11
translation: MLNLRGVEIRKGALDGPAQARLIEALRPVLKAAPLFTPTMPNGKPLSVRMTSAGSLGWVT DKGGYRYQPTHPKGMAWPAIPPEVLDLWHGVTGQDRAPDCCLINYYGEGARMGLHQDRDE ADLTWPVVSLSLGDDALFRIGNTSRGGKTESVWLNSGDVVVMGGPARLIYHGIDRIRFGS SRLLPKGGRLNLTLRVAG
>SPO0042 class=Sequence position=DSS3:41882..42478 (- strand)
ATGTTGAACC TGCGTGGTGT CGAGATTCGC AAAGGCGCGC TCGACGGGCC GGCCCAGGCA CGGCTGATCG AGGCATTGCG
CCCGGTTCTG AAGGCCGCGC CGCTGTTCAC CCCCACCATG CCGAACGGCA AGCCGCTGTC GGTGCGGATG ACCTCGGCAG
GGTCGCTGGG ATGGGTGACC GACAAGGGCG GCTATCGCTA TCAGCCGACC CATCCGAAGG GCATGGCCTG GCCCGCGATT
CCGCCCGAGG TGCTGGATCT GTGGCACGGG GTCACGGGTC AGGATCGCGC GCCCGATTGC TGCCTGATCA ACTATTATGG
CGAGGGCGCC CGGATGGGCC TGCACCAGGA TCGCGACGAA GCCGATCTGA CCTGGCCCGT GGTGTCGCTG TCACTGGGCG
ATGACGCCCT GTTTCGCATC GGCAATACCA GCCGGGGAGG CAAGACGGAA TCGGTCTGGC TGAACTCGGG CGATGTGGTG
GTGATGGGCG GACCGGCGCG GCTGATCTAT CACGGGATCG ACCGGATCCG GTTCGGCTCG TCCCGGCTGT TGCCCAAAGG
CGGGCGGCTG AACCTGACGC TGCGGGTTGC GGGCTAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7