Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0046
Type: gene
Description:
Source: Genbank
Position: CP000031.2:46922..47899 (+ strand)
Length: 978
gbkey: Gene
gene: SPO0046
gene_biotype: protein_coding
load_id: gene-SPO0046
locus_tag: SPO0046
Parts:
Type: CDS
Description: identified by match to protein family HMM PF01266
Source: Genbank
Position: CP000031.2:46922..47899 (+ strand)
Length: 978
"ID: cds-AAV93377.1
Dbxref: NCBI_GP:AAV93377.1
IMG: SPO0046: glycine oxidase (EC 1.4.3.19)
Note: identified by match to protein family HMM PF01266
RefSeq: SPO_RS00230: FAD-dependent oxidoreductase"
gbkey: CDS
gene: SPO0046
locus_tag: SPO0046
parent_id: gene-SPO0046
product: thiamine biosynthesis oxidoreductase ThiO
  putative
protein_id: AAV93377.1
transl_table: 11
translation: MTLWSVIGAGVAGLTVATEMVARGARVQVFDPGGPPGPHGCSWWAGGMLAPWCEYENAEE PVLRLGQQAIGWWEQHTTVTRRGTLVVANPRDLPDLRRFGRRTEGFREINQTEILGLESD LGAFSKGLHFPDEAHLDPRRALSDLYRGLLDKDVDFHRKPAPAGLENAIDCRGLHAREVL HDLRGVKGEMLVIRAPDVALTRPVRLLHPRMPLYVVPRADHVYMLGATMIESEDSGRITA RSMLELLSAAYALNPAFGEAEVLEIGVDLRPAFPDNLPRIRRLGRTIYANGLYRHGYLLA PALAQGVADLALNNTHTELVDEDRA
>SPO0046 class=Sequence position=CP000031.2:46922..47899 (+ strand)
ATGACGCTGT GGTCGGTCAT CGGGGCCGGT GTGGCCGGAT TGACCGTCGC GACCGAGATG GTCGCGCGCG GTGCCAGAGT
GCAGGTGTTC GATCCGGGTG GCCCACCGGG CCCGCATGGC TGCAGCTGGT GGGCGGGCGG CATGCTGGCG CCATGGTGCG
AGTACGAGAA TGCCGAGGAA CCGGTCTTGC GCCTGGGCCA GCAAGCCATC GGCTGGTGGG AGCAACATAC CACCGTCACG
CGTCGCGGCA CACTTGTGGT GGCCAATCCG CGCGATCTGC CCGATCTGCG CCGGTTCGGT CGCCGGACAG AAGGGTTTCG
CGAAATCAAT CAGACGGAAA TCCTTGGCTT AGAGTCTGAT CTCGGTGCGT TCTCCAAAGG GCTTCATTTC CCGGACGAGG
CGCATCTGGA TCCCCGCCGC GCACTCTCTG ATCTTTATCG CGGTTTGCTC GACAAGGATG TGGATTTCCA CCGAAAACCC
GCCCCCGCCG GGTTGGAAAA TGCCATCGAT TGCCGCGGGC TGCATGCGCG CGAGGTGCTG CACGACCTGC GCGGCGTCAA
AGGGGAGATG CTGGTCATTC GCGCCCCGGA TGTGGCTCTG ACACGCCCGG TCCGATTGCT TCATCCCCGC ATGCCGCTTT
ATGTCGTGCC CCGCGCTGAC CATGTCTACA TGCTCGGCGC AACTATGATC GAGAGTGAGG ACAGCGGCCG CATCACAGCG
CGCTCCATGC TGGAGCTGCT CAGCGCCGCC TATGCCCTGA ACCCCGCCTT TGGCGAGGCC GAGGTGCTGG AGATCGGCGT
CGATCTGCGC CCGGCCTTTC CCGACAACCT GCCGCGCATC CGGCGGTTGG GGCGGACCAT TTATGCCAAT GGCCTTTATC
GCCACGGCTA CCTGCTGGCG CCCGCGCTGG CGCAAGGGGT GGCCGACCTG GCGCTCAATA ACACGCATAC GGAGTTGGTC
GATGAAGATC GTGCTTAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7