Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0049
Type: gene
Description:
Source: Genbank
Position: CP000031.2:49417..50400 (+ strand)
Length: 984
gbkey: Gene
gene: SPO0049
gene_biotype: protein_coding
load_id: gene-SPO0049
locus_tag: SPO0049
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00899; match to protein family HMM PF05237
Source: Genbank
Position: CP000031.2:49417..50400 (+ strand)
Length: 984
Dbxref: NCBI_GP:AAV93380.1
IMG: SPO0049: thiamine biosynthesis protein ThiF
Note: identified by match to protein family HMM PF00899; match to protein family HMM PF05237
RefSeq: SPO_RS00250: thiamine biosynthesis protein ThiF
gbkey: CDS
gene: SPO0049
load_id: cds-AAV93380.1
locus_tag: SPO0049
parent_id: gene-SPO0049
product: thiamine biosynthesis protein ThiF
protein_id: AAV93380.1
transl_table: 11
translation: MDRGHEMSRYARQMILPQAGGEGQARLAGARVLVVGAGGLAASALPLLAGAGVGQIDIFD GDHIELSNLHRQTLFAEGDVGRAKAEVAAERCGALNSGIVLTGTKRSITPENVILACRDT DLVLDCADSYAASYLLSDTCQALGKPLISASVLGLGGYVGGFCGGAPSLRAVFPDAPDSA ASCATAGVLGPVVSILGSIQAQMALSALLELAPSPLGQMVQIDALSWRNSTFRFDGAPEP ATAFRFVAPSDLSADDLIVELRTEGEAPQPAHPSARRMTVSEIEISDTNKEKRLALCCAT GLRAWRSAEQLQPIWPGEIVLVAAATS
>SPO0049 class=Sequence position=CP000031.2:49417..50400 (+ strand)
ATGGATCGAG GTCACGAGAT GAGCCGCTAT GCCCGCCAGA TGATCCTGCC GCAGGCCGGG GGTGAGGGGC AGGCACGATT
GGCTGGTGCC CGCGTGTTGG TGGTCGGGGC CGGGGGCCTC GCGGCCTCGG CGCTACCGCT GCTTGCCGGG GCAGGGGTCG
GGCAGATCGA CATTTTCGAT GGTGACCACA TCGAGCTGTC GAACCTGCAC CGGCAGACGC TGTTTGCCGA GGGCGATGTT
GGGCGGGCCA AGGCCGAGGT CGCTGCCGAA CGCTGTGGCG CGCTCAATTC CGGGATTGTC CTGACCGGTA CAAAACGGTC
GATCACCCCG GAAAACGTGA TCTTGGCCTG CCGGGACACC GATCTGGTGC TGGATTGTGC CGATAGCTAT GCCGCAAGCT
ATCTGCTCAG CGATACCTGT CAGGCGTTGG GCAAACCGCT GATCAGCGCT TCGGTTCTGG GGCTGGGCGG ATACGTCGGC
GGCTTTTGTG GCGGCGCACC CAGTCTGCGC GCGGTGTTCC CCGACGCACC GGACAGCGCA GCAAGCTGCG CGACCGCTGG
CGTGCTGGGG CCGGTAGTCT CCATATTAGG CTCTATACAG GCGCAAATGG CGCTTTCGGC GTTGCTTGAA TTGGCGCCTT
CACCGCTTGG GCAGATGGTG CAGATCGACG CGCTATCCTG GCGCAACAGC ACGTTCCGCT TTGACGGCGC GCCGGAACCG
GCAACTGCCT TCCGCTTTGT CGCGCCCTCG GACCTGAGCG CCGATGACCT GATCGTCGAA CTGCGGACCG AAGGTGAGGC
GCCCCAACCC GCGCACCCAT CCGCCCGCCG AATGACGGTA TCCGAGATCG AAATATCAGA CACTAACAAA GAAAAACGGC
TGGCTCTCTG TTGTGCCACC GGCCTCAGGG CCTGGCGCTC TGCGGAACAG TTGCAACCGA TTTGGCCGGG CGAGATCGTT
CTCGTTGCGG CCGCCACATC ATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7