Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0050
Type: CDS
Description: Assignment based partly on membership in ABC transporter gene cluster.; NCBI:ABC transporter ATP-binding protein; IMG:putative hydroxymethylpyrimidine transport system substrate-binding protein
Source: GenBank
Position: DSS3:50309..51349 (+ strand)
Length: 1041
Dbxref: GI:56694978
  GeneID:3192843
Note: Assignment based partly on membership in ABC transporter gene cluster.
  NCBI:ABC transporter ATP-binding protein
  IMG:putative hydroxymethylpyrimidine transport system substrate-binding protein
codon_start: 1
load_id: SPO0050.p01
parent_id: SPO0050.t01
product: ABC transporter, periplasmic substrate-binding protein
protein_id: REF_tigr:SPO0050
  YP_165324.1
transl_table: 11
translation: MPPASGPGALRNSCNRFGRARSFSLRPPHHERKRDMKHLVTALALLAATPALAQDKMTLL LDWFINPDHGPIIVAQEKGYFAERGLEVEIVAPADPSAPPRLVAAGQADLAVSYQPQLHL QIHEGLPLKRVGTLVATPLNCLLVLDNGPIKSPADLKGKKIGFSVAGVEEAILTTVLGKY DVALSDVEMINVNFSLSPALMSGQVDAVIGAYRNFELNQMDIEGEPGRCFYIEEEGVPSY DELIYVANPDRMDAGKIARFLEATEKATQFIVNNPQASWEIFSATSPELQDELNKRAWAD TLPRFALRPAGFDAGRYARFETFLKDSGMIDSVNSVSAITIDVTAE
>SPO0050 class=Sequence position=DSS3:50309..51349 (+ strand)
GTGCCACCGG CCTCAGGGCC TGGCGCTCTG CGGAACAGTT GCAACCGATT TGGCCGGGCG AGATCGTTCT CGTTGCGGCC
GCCACATCAT GAAAGGAAAC GCGACATGAA ACACCTGGTA ACCGCATTGG CGCTGCTGGC CGCCACGCCC GCCCTGGCGC
AGGACAAGAT GACCCTGCTG CTCGATTGGT TCATCAACCC TGACCACGGC CCGATCATCG TGGCGCAGGA AAAGGGATAC
TTCGCCGAAC GCGGGCTGGA GGTCGAGATC GTGGCCCCCG CCGACCCCTC GGCCCCGCCG CGTCTGGTCG CTGCCGGTCA
GGCCGATCTG GCGGTCAGCT ATCAGCCGCA ACTGCACCTG CAAATCCACG AGGGGCTGCC CCTGAAACGT GTCGGCACGC
TGGTCGCCAC CCCCCTCAAC TGCCTGCTGG TACTGGACAA CGGCCCGATC AAATCGCCCG CCGACCTCAA GGGCAAGAAG
ATCGGCTTCT CTGTTGCAGG CGTCGAAGAG GCGATCCTGA CCACGGTTCT GGGTAAATAC GATGTCGCGC TCAGCGATGT
CGAGATGATC AACGTGAACT TCTCGCTCTC GCCCGCGCTG ATGAGCGGAC AGGTCGATGC GGTGATCGGC GCCTATCGCA
ATTTCGAGTT GAATCAGATG GATATCGAGG GCGAGCCGGG TCGCTGTTTC TATATCGAGG AAGAAGGCGT GCCGTCTTAT
GACGAGCTGA TCTATGTCGC CAACCCCGAC CGGATGGATG CCGGCAAGAT CGCGCGCTTC CTTGAGGCCA CCGAAAAGGC
GACGCAGTTC ATCGTCAACA ACCCGCAAGC AAGCTGGGAA ATCTTCTCGG CGACTTCGCC CGAATTGCAG GACGAACTGA
ACAAGCGCGC CTGGGCCGAT ACGCTGCCGC GCTTTGCGCT GCGTCCTGCT GGGTTCGACG CGGGCCGCTA TGCCCGGTTC
GAGACGTTTC TGAAGGACAG CGGGATGATC GACAGCGTGA ACTCAGTCTC GGCCATCACC ATCGACGTGA CCGCCGAATG
A

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7