Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0051
Type: gene
Description:
Source: Genbank
Position: CP000031.2:51382..52026 (+ strand)
Length: 645
gbkey: Gene
gene: SPO0051
gene_biotype: protein_coding
load_id: gene-SPO0051
locus_tag: SPO0051
Parts:
Type: CDS
Description: identified by match to protein family HMM PF03070
Source: Genbank
Position: CP000031.2:51382..52026 (+ strand)
Length: 645
Dbxref: NCBI_GP:AAV93382.1
IMG: SPO0051: TENA/THI-4 family protein
Note: identified by match to protein family HMM PF03070
RefSeq: SPO_RS00260: tenA: thiaminase II
gbkey: CDS
gene: SPO0051
load_id: cds-AAV93382.1
locus_tag: SPO0051
parent_id: gene-SPO0051
product: TENA/THI-4 family protein
protein_id: AAV93382.1
transl_table: 11
translation: MRAAAGQPWRDYTRHAFVEGMKDGSLARDAFVHYLRQDYVFLIHFARAWALAVVKGETHA EMLAAVGTVNTLVVEEMQLHVGVCEAAGISKDALFATPERPENLAYTRFVLEAGYSGDLA DLLAALAPCVMGYGEIGARLATEATSEAYKDWIDTYAGPEYQAACKAVGELMDQALTRRI GADFEASPRWERLCRTFRTATELEVGFWQMGLTP
>SPO0051 class=Sequence position=CP000031.2:51382..52026 (+ strand)
ATGCGCGCGG CGGCGGGCCA GCCGTGGCGG GATTATACCC GCCACGCCTT TGTCGAGGGG ATGAAGGATG GCAGCCTGGC
GCGCGATGCA TTTGTGCACT ATCTGCGGCA GGATTACGTG TTCCTGATCC ACTTTGCCCG CGCCTGGGCG CTGGCCGTGG
TCAAGGGCGA AACCCATGCC GAGATGCTGG CCGCCGTTGG CACTGTCAAC ACGCTGGTGG TCGAGGAAAT GCAGCTGCAT
GTCGGTGTGT GCGAGGCGGC CGGGATCTCG AAGGACGCGC TGTTCGCCAC GCCCGAGCGA CCCGAAAACC TCGCCTATAC
CCGCTTCGTG CTCGAGGCCG GGTATAGCGG CGATCTGGCC GATCTGCTGG CGGCGCTGGC GCCCTGTGTC ATGGGCTATG
GCGAGATCGG CGCGCGGCTG GCGACAGAGG CCACCAGCGA GGCCTACAAG GACTGGATCG ACACCTATGC AGGGCCCGAG
TATCAAGCCG CGTGCAAGGC GGTGGGCGAG TTGATGGATC AGGCTCTGAC AAGGCGTATC GGCGCGGATT TCGAAGCCTC
TCCACGATGG GAGCGCCTGT GCCGGACCTT TCGCACCGCG ACCGAGCTAG AGGTCGGTTT CTGGCAGATG GGGTTGACCC
CGTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7