Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0052
Type: gene
Description:
Source: Genbank
Position: CP000031.2:51960..52751 (+ strand)
Length: 792
gbkey: Gene
gene: SPO0052
gene_biotype: protein_coding
load_id: gene-SPO0052
locus_tag: SPO0052
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00005
Source: Genbank
Position: CP000031.2:51960..52751 (+ strand)
Length: 792
"ID: cds-AAV93383.1
Dbxref: NCBI_GP:AAV93383.1
IMG: SPO0052: ABC transporter
  ATP-binding protein
Note: identified by match to protein family HMM PF00005
RefSeq: SPO_RS00265: ABC transporter ATP-binding protein"
gbkey: CDS
gene: SPO0052
locus_tag: SPO0052
parent_id: gene-SPO0052
product: ABC transporter
  ATP-binding protein
protein_id: AAV93383.1
transl_table: 11
translation: MPDLSHRDRARGRFLADGVDPVTPAPAITVAGSASIDGARLFAPLTLTLEAAQWTCLLGG SGVGKSTVLRLIAGLETGAEFSGAITASDDAPVLKRVAYMAQDDLLLPWATVAQNVGLGA RLRGEQVDRARLDDLLRRVRLTAHAAKRPAELSGGQRQRVALARTLMEDKPVVLLDEPFS ALDARTRADMQELAAELLAGRTVLLVTHDPAEAARLGHSIQVMTAAGLTPVAPPTAQIPR AVDDAATLECQAALLRMLREGVQ
>SPO0052 class=Sequence position=CP000031.2:51960..52751 (+ strand)
GTGCCGGACC TTTCGCACCG CGACCGAGCT AGAGGTCGGT TTCTGGCAGA TGGGGTTGAC CCCGTGACTC CGGCCCCCGC
GATCACCGTT GCCGGCAGCG CCAGCATCGA CGGCGCGCGC CTGTTTGCGC CGCTGACCCT GACATTGGAG GCGGCGCAAT
GGACCTGCCT GCTGGGGGGG TCGGGCGTTG GAAAGTCGAC GGTGCTGCGG CTGATTGCGG GGCTGGAAAC CGGGGCAGAG
TTCAGCGGTG CCATTACCGC ATCGGACGAT GCGCCGGTGT TGAAACGGGT GGCCTATATG GCGCAGGACG ACCTCTTGTT
GCCCTGGGCC ACGGTGGCGC AGAACGTGGG CTTGGGCGCG CGGTTGCGGG GCGAACAGGT GGACCGGGCC CGGCTGGACG
ACCTGCTGCG CCGGGTGCGG CTGACCGCTC ACGCCGCCAA GCGTCCGGCA GAGCTGTCCG GTGGCCAACG CCAGCGGGTG
GCGCTTGCGC GTACCTTGAT GGAGGACAAG CCCGTTGTGC TGCTGGACGA GCCTTTCTCG GCGCTCGATG CCCGCACGCG
TGCGGATATG CAGGAGCTGG CCGCCGAGCT ATTGGCCGGG CGAACCGTGC TGCTGGTGAC GCACGACCCG GCCGAGGCCG
CACGGCTGGG CCATTCGATC CAGGTGATGA CCGCCGCAGG GCTGACGCCG GTGGCGCCGC CGACGGCACA GATACCGCGC
GCGGTGGATG ACGCGGCGAC GCTGGAATGT CAGGCCGCGC TGCTCAGGAT GCTGCGGGAG GGTGTGCAAT GA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7