Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0052
Type: gene
Description:
Source: GenBank
Position: DSS3:51960..52751 (+ strand)
Length: 792
Dbxref: GeneID:3193579
load_id: SPO0052
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:51960..52751 (+ strand)
Length: 792
load_id: SPO0052.t01
parent_id: SPO0052
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00005; NCBI:ABC transporter ATPase; IMG:putative hydroxymethylpyrimidine transport system ATP-binding protein
Source: GenBank
Position: DSS3:51960..52751 (+ strand)
Length: 792
Dbxref: GI:56694980
  GeneID:3193579
Note: identified by match to protein family HMM PF00005
  NCBI:ABC transporter ATPase
  IMG:putative hydroxymethylpyrimidine transport system ATP-binding protein
codon_start: 1
load_id: SPO0052.p01
parent_id: SPO0052.t01
product: ABC transporter, ATP-binding protein
protein_id: REF_tigr:SPO0052
  YP_165326.1
transl_table: 11
translation: MPDLSHRDRARGRFLADGVDPVTPAPAITVAGSASIDGARLFAPLTLTLEAAQWTCLLGG SGVGKSTVLRLIAGLETGAEFSGAITASDDAPVLKRVAYMAQDDLLLPWATVAQNVGLGA RLRGEQVDRARLDDLLRRVRLTAHAAKRPAELSGGQRQRVALARTLMEDKPVVLLDEPFS ALDARTRADMQELAAELLAGRTVLLVTHDPAEAARLGHSIQVMTAAGLTPVAPPTAQIPR AVDDAATLECQAALLRMLREGVQ
Type: exon
Description:
Source: GenBank
Position: DSS3:51960..52751 (+ strand)
Length: 792
parent_id: SPO0052.t01
> class=Sequence position=DSS3:51960..52751 (+ strand)
GTGCCGGACC TTTCGCACCG CGACCGAGCT AGAGGTCGGT TTCTGGCAGA TGGGGTTGAC CCCGTGACTC CGGCCCCCGC
GATCACCGTT GCCGGCAGCG CCAGCATCGA CGGCGCGCGC CTGTTTGCGC CGCTGACCCT GACATTGGAG GCGGCGCAAT
GGACCTGCCT GCTGGGGGGG TCGGGCGTTG GAAAGTCGAC GGTGCTGCGG CTGATTGCGG GGCTGGAAAC CGGGGCAGAG
TTCAGCGGTG CCATTACCGC ATCGGACGAT GCGCCGGTGT TGAAACGGGT GGCCTATATG GCGCAGGACG ACCTCTTGTT
GCCCTGGGCC ACGGTGGCGC AGAACGTGGG CTTGGGCGCG CGGTTGCGGG GCGAACAGGT GGACCGGGCC CGGCTGGACG
ACCTGCTGCG CCGGGTGCGG CTGACCGCTC ACGCCGCCAA GCGTCCGGCA GAGCTGTCCG GTGGCCAACG CCAGCGGGTG
GCGCTTGCGC GTACCTTGAT GGAGGACAAG CCCGTTGTGC TGCTGGACGA GCCTTTCTCG GCGCTCGATG CCCGCACGCG
TGCGGATATG CAGGAGCTGG CCGCCGAGCT ATTGGCCGGG CGAACCGTGC TGCTGGTGAC GCACGACCCG GCCGAGGCCG
CACGGCTGGG CCATTCGATC CAGGTGATGA CCGCCGCAGG GCTGACGCCG GTGGCGCCGC CGACGGCACA GATACCGCGC
GCGGTGGATG ACGCGGCGAC GCTGGAATGT CAGGCCGCGC TGCTCAGGAT GCTGCGGGAG GGTGTGCAAT GA
>SPO0052 class=Sequence position=DSS3:51960..52751 (+ strand)
GTGCCGGACC TTTCGCACCG CGACCGAGCT AGAGGTCGGT TTCTGGCAGA TGGGGTTGAC CCCGTGACTC CGGCCCCCGC
GATCACCGTT GCCGGCAGCG CCAGCATCGA CGGCGCGCGC CTGTTTGCGC CGCTGACCCT GACATTGGAG GCGGCGCAAT
GGACCTGCCT GCTGGGGGGG TCGGGCGTTG GAAAGTCGAC GGTGCTGCGG CTGATTGCGG GGCTGGAAAC CGGGGCAGAG
TTCAGCGGTG CCATTACCGC ATCGGACGAT GCGCCGGTGT TGAAACGGGT GGCCTATATG GCGCAGGACG ACCTCTTGTT
GCCCTGGGCC ACGGTGGCGC AGAACGTGGG CTTGGGCGCG CGGTTGCGGG GCGAACAGGT GGACCGGGCC CGGCTGGACG
ACCTGCTGCG CCGGGTGCGG CTGACCGCTC ACGCCGCCAA GCGTCCGGCA GAGCTGTCCG GTGGCCAACG CCAGCGGGTG
GCGCTTGCGC GTACCTTGAT GGAGGACAAG CCCGTTGTGC TGCTGGACGA GCCTTTCTCG GCGCTCGATG CCCGCACGCG
TGCGGATATG CAGGAGCTGG CCGCCGAGCT ATTGGCCGGG CGAACCGTGC TGCTGGTGAC GCACGACCCG GCCGAGGCCG
CACGGCTGGG CCATTCGATC CAGGTGATGA CCGCCGCAGG GCTGACGCCG GTGGCGCCGC CGACGGCACA GATACCGCGC
GCGGTGGATG ACGCGGCGAC GCTGGAATGT CAGGCCGCGC TGCTCAGGAT GCTGCGGGAG GGTGTGCAAT GA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7