Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0053
Type: CDS
Description: identified by match to protein family HMM PF00528; NCBI:ABC transporter permease; IMG:putative hydroxymethylpyrimidine transport system permease protein
Source: GenBank
Position: DSS3:52706..53482 (+ strand)
Length: 777
Dbxref: GI:56694981
  GeneID:3196528
Note: identified by match to protein family HMM PF00528
  NCBI:ABC transporter permease
  IMG:putative hydroxymethylpyrimidine transport system permease protein
codon_start: 1
load_id: SPO0053.p01
parent_id: SPO0053.t01
product: ABC transporter, permease protein
protein_id: REF_tigr:SPO0053
  YP_165327.1
transl_table: 11
translation: MSGRAAQDAAGGCAMTRWLPAVAATLFALAIWQAVVSLTDLPRFILPGPVLVAETWWQSR WLIAEHTAVTALEVLIGLACGAVLGVATALQLASSRIARVLVQPMLVFTQALPVFALAPI LTLWLGYGLWSKVAMAVLIIYFPITAAFFDGLMRTPVGYLDLARTMQASPRAVLWHIRVP AALPQLASGLRLAAVYAPIGAVIGEWVGASKGLGYLMLLANGRAKTDLMFAAMLTLGVLS VLLHLAMRRATRRMAGER
>SPO0053 class=Sequence position=DSS3:52706..53482 (+ strand)
ATGTCAGGCC GCGCTGCTCA GGATGCTGCG GGAGGGTGTG CAATGACACG CTGGCTCCCC GCTGTTGCGG CAACCCTTTT
TGCGCTGGCA ATCTGGCAGG CGGTGGTCAG CCTGACCGAC CTGCCGCGCT TCATCCTGCC GGGGCCGGTG CTGGTGGCCG
AAACCTGGTG GCAGAGCCGC TGGCTGATCG CCGAACATAC GGCGGTGACC GCGCTCGAGG TTCTGATCGG TCTCGCCTGT
GGCGCGGTGC TGGGTGTGGC GACGGCGTTG CAGCTGGCCA GTTCGCGGAT CGCGCGGGTT CTGGTGCAGC CGATGCTGGT
CTTTACCCAG GCGCTGCCGG TCTTTGCGCT GGCTCCGATC CTGACGCTGT GGCTGGGCTA TGGGCTGTGG TCCAAGGTCG
CTATGGCCGT GCTGATCATC TATTTCCCGA TCACGGCGGC GTTTTTCGAC GGGCTGATGC GGACGCCTGT CGGCTACCTC
GACCTTGCCC GCACCATGCA GGCCAGCCCG CGCGCGGTGC TTTGGCATAT CCGAGTGCCG GCGGCGCTGC CGCAACTTGC
CTCGGGCCTG CGGTTGGCGG CGGTCTATGC GCCGATCGGT GCGGTGATCG GCGAGTGGGT GGGCGCGTCA AAGGGGCTGG
GGTATCTGAT GCTGTTGGCC AATGGACGCG CCAAGACCGA CCTGATGTTC GCCGCCATGC TGACGCTGGG CGTGTTGTCG
GTTCTGCTGC ATCTGGCGAT GCGGCGGGCG ACGCGGCGGA TGGCGGGCGA GCGTTAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7