Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0055
Type: gene
Description:
Source: Genbank
Position: CP000031.2:54337..55893 (- strand)
Length: 1557
gbkey: Gene
gene: SPO0055
gene_biotype: protein_coding
load_id: gene-SPO0055
locus_tag: SPO0055
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00691
Source: Genbank
Position: CP000031.2:54337..55893 (- strand)
Length: 1557
"ID: cds-AAV93386.1
Dbxref: NCBI_GP:AAV93386.1
IMG: SPO0055: phosphate ABC transporter substrate-binding protein
  PhoT family (TC 3.A.1.7.1)
Note: identified by match to protein family HMM PF00691
RefSeq: SPO_RS00280: OmpA family protein"
gbkey: CDS
gene: SPO0055
locus_tag: SPO0055
parent_id: gene-SPO0055
product: OmpA domain protein
protein_id: AAV93386.1
transl_table: 11
translation: MNWLRAAALAALSVFPAVPAAAQDITLTSHDGKVEISGNLLGFDGEFYRVETRFGELTVD GSGVTCDGPACPNLTDFVAELALSGSSTMAEVLLPALIEGFALRNRMQTRRETDSEARFS YLLFQAGSDRPQARFTFRVSTTDEGFADLLADEADLVMALREIRPDERRRALELGLGDMT DSNRSRVLALDAMVPVVAPVNPVRQVSVPQLAQVFAGEIDNWAQLGGPDAPIALHLPAAG SGLAQAVEDRLLLPAGKSLPETVARHDRSSLLARAVAIDPFAIGIASYSETGTARALTLT GDCGFSLAATRRNIKTEDYPLNSPMFLYMPARRLPKLAREFMAYMRSPAAQIVIRRAGFV DQAPELIPVAVQGNRLANAIAAAGTEVPLTELQRLVSTLSGMQRLSLSFRFETGSSRPDA QSRTNISQLAQELESGAYDARQLLFVGFSDGDGAAEGNTRIALKRAEAVRDAVLQTAETL DPARVEVSVDAFGEALPMACDDSDWGRQVNRRVEVWVK
>SPO0055 class=Sequence position=CP000031.2:54337..55893 (- strand)
ATGAATTGGC TTCGTGCGGC GGCTCTCGCC GCACTTTCCG TTTTCCCGGC GGTCCCGGCC GCCGCGCAGG ACATCACCCT
CACCTCGCAT GACGGCAAGG TCGAGATCAG CGGAAACTTG CTTGGTTTCG ACGGCGAATT CTATCGCGTC GAAACCCGCT
TCGGTGAACT GACGGTGGAC GGTTCCGGCG TCACCTGTGA CGGTCCGGCC TGTCCGAACC TGACCGACTT TGTCGCCGAA
CTGGCGCTGA GCGGATCCTC GACCATGGCC GAGGTGCTGC TGCCTGCATT GATCGAGGGG TTTGCCCTGC GCAACCGCAT
GCAGACCCGG CGCGAGACCG ATAGCGAGGC GCGCTTCAGC TATCTGCTGT TCCAGGCCGG CAGTGACAGA CCGCAGGCCC
GCTTCACCTT TCGCGTCAGC ACCACCGACG AGGGCTTTGC CGACCTGCTG GCGGACGAGG CCGATCTGGT GATGGCGCTG
CGTGAAATCC GCCCCGACGA ACGCCGGCGG GCGCTGGAAT TGGGTCTGGG CGACATGACC GACAGCAACC GCTCGCGGGT
GCTAGCGCTG GATGCGATGG TGCCGGTGGT GGCGCCCGTC AATCCGGTGC GCCAGGTCTC GGTCCCGCAG CTGGCACAGG
TCTTCGCCGG CGAGATCGAC AACTGGGCGC AGCTTGGCGG CCCGGACGCC CCCATCGCGC TGCATCTGCC CGCAGCGGGC
TCGGGGTTGG CGCAAGCGGT CGAAGACCGC CTGCTTCTGC CCGCCGGTAA ATCCCTGCCC GAAACGGTCG CCCGCCATGA
CCGCTCCAGC CTGTTGGCCC GCGCAGTTGC CATCGACCCG TTTGCCATCG GCATCGCCAG CTACTCCGAG ACAGGCACCG
CGCGGGCACT GACCCTGACC GGAGATTGCG GCTTTTCCCT TGCTGCCACC CGCCGCAATA TCAAGACCGA GGATTATCCG
CTCAACTCGC CCATGTTTCT TTACATGCCC GCGCGCCGCC TGCCCAAGCT GGCGCGCGAA TTCATGGCCT ATATGCGCAG
CCCGGCGGCA CAGATCGTGA TCCGCCGCGC CGGTTTCGTC GATCAGGCAC CCGAGTTGAT CCCGGTCGCC GTCCAGGGCA
ACCGGCTGGC CAATGCCATC GCCGCAGCCG GCACCGAGGT GCCGCTGACC GAGTTGCAAC GCCTCGTCTC GACCCTGTCC
GGCATGCAGC GGCTCAGCCT GTCTTTCCGG TTCGAGACCG GATCCTCGCG CCCCGATGCC CAGTCGCGCA CCAATATCTC
GCAACTGGCC CAGGAACTTG AAAGCGGTGC CTATGACGCG CGCCAATTGC TCTTTGTCGG GTTCAGCGAT GGCGACGGCG
CGGCCGAGGG CAATACCCGC ATCGCGCTGA AGCGGGCCGA AGCGGTACGC GACGCGGTCT TGCAGACCGC CGAAACACTC
GACCCGGCCC GGGTGGAAGT CTCGGTCGAC GCATTTGGCG AGGCGCTGCC GATGGCCTGT GACGACAGCG ATTGGGGCCG
CCAGGTCAAC CGCCGGGTCG AGGTCTGGGT GAAATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7