Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0055
Type: gene
Description:
Source: GenBank
Position: DSS3:54337..55893 (- strand)
Length: 1557
Dbxref: GeneID:3194535
load_id: SPO0055
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:54337..55893 (- strand)
Length: 1557
load_id: SPO0055.t01
parent_id: SPO0055
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00691; NCBI:cell envelope biogenesis protein OmpA; IMG:phosphate ABC transporter substrate-binding protein; PhoT family
Source: GenBank
Position: DSS3:54337..55893 (- strand)
Length: 1557
Dbxref: GI:56694983
  GeneID:3194535
Note: identified by match to protein family HMM PF00691
  NCBI:cell envelope biogenesis protein OmpA
  IMG:phosphate ABC transporter substrate-binding protein
  PhoT family
codon_start: 1
load_id: SPO0055.p01
parent_id: SPO0055.t01
product: OmpA domain protein
protein_id: REF_tigr:SPO0055
  YP_165329.1
transl_table: 11
translation: MNWLRAAALAALSVFPAVPAAAQDITLTSHDGKVEISGNLLGFDGEFYRVETRFGELTVD GSGVTCDGPACPNLTDFVAELALSGSSTMAEVLLPALIEGFALRNRMQTRRETDSEARFS YLLFQAGSDRPQARFTFRVSTTDEGFADLLADEADLVMALREIRPDERRRALELGLGDMT DSNRSRVLALDAMVPVVAPVNPVRQVSVPQLAQVFAGEIDNWAQLGGPDAPIALHLPAAG SGLAQAVEDRLLLPAGKSLPETVARHDRSSLLARAVAIDPFAIGIASYSETGTARALTLT GDCGFSLAATRRNIKTEDYPLNSPMFLYMPARRLPKLAREFMAYMRSPAAQIVIRRAGFV DQAPELIPVAVQGNRLANAIAAAGTEVPLTELQRLVSTLSGMQRLSLSFRFETGSSRPDA QSRTNISQLAQELESGAYDARQLLFVGFSDGDGAAEGNTRIALKRAEAVRDAVLQTAETL DPARVEVSVDAFGEALPMACDDSDWGRQVNRRVEVWVK
Type: exon
Description:
Source: GenBank
Position: DSS3:54337..55893 (- strand)
Length: 1557
parent_id: SPO0055.t01
> class=Sequence position=DSS3:54337..55893 (- strand)
ATGAATTGGC TTCGTGCGGC GGCTCTCGCC GCACTTTCCG TTTTCCCGGC GGTCCCGGCC GCCGCGCAGG ACATCACCCT
CACCTCGCAT GACGGCAAGG TCGAGATCAG CGGAAACTTG CTTGGTTTCG ACGGCGAATT CTATCGCGTC GAAACCCGCT
TCGGTGAACT GACGGTGGAC GGTTCCGGCG TCACCTGTGA CGGTCCGGCC TGTCCGAACC TGACCGACTT TGTCGCCGAA
CTGGCGCTGA GCGGATCCTC GACCATGGCC GAGGTGCTGC TGCCTGCATT GATCGAGGGG TTTGCCCTGC GCAACCGCAT
GCAGACCCGG CGCGAGACCG ATAGCGAGGC GCGCTTCAGC TATCTGCTGT TCCAGGCCGG CAGTGACAGA CCGCAGGCCC
GCTTCACCTT TCGCGTCAGC ACCACCGACG AGGGCTTTGC CGACCTGCTG GCGGACGAGG CCGATCTGGT GATGGCGCTG
CGTGAAATCC GCCCCGACGA ACGCCGGCGG GCGCTGGAAT TGGGTCTGGG CGACATGACC GACAGCAACC GCTCGCGGGT
GCTAGCGCTG GATGCGATGG TGCCGGTGGT GGCGCCCGTC AATCCGGTGC GCCAGGTCTC GGTCCCGCAG CTGGCACAGG
TCTTCGCCGG CGAGATCGAC AACTGGGCGC AGCTTGGCGG CCCGGACGCC CCCATCGCGC TGCATCTGCC CGCAGCGGGC
TCGGGGTTGG CGCAAGCGGT CGAAGACCGC CTGCTTCTGC CCGCCGGTAA ATCCCTGCCC GAAACGGTCG CCCGCCATGA
CCGCTCCAGC CTGTTGGCCC GCGCAGTTGC CATCGACCCG TTTGCCATCG GCATCGCCAG CTACTCCGAG ACAGGCACCG
CGCGGGCACT GACCCTGACC GGAGATTGCG GCTTTTCCCT TGCTGCCACC CGCCGCAATA TCAAGACCGA GGATTATCCG
CTCAACTCGC CCATGTTTCT TTACATGCCC GCGCGCCGCC TGCCCAAGCT GGCGCGCGAA TTCATGGCCT ATATGCGCAG
CCCGGCGGCA CAGATCGTGA TCCGCCGCGC CGGTTTCGTC GATCAGGCAC CCGAGTTGAT CCCGGTCGCC GTCCAGGGCA
ACCGGCTGGC CAATGCCATC GCCGCAGCCG GCACCGAGGT GCCGCTGACC GAGTTGCAAC GCCTCGTCTC GACCCTGTCC
GGCATGCAGC GGCTCAGCCT GTCTTTCCGG TTCGAGACCG GATCCTCGCG CCCCGATGCC CAGTCGCGCA CCAATATCTC
GCAACTGGCC CAGGAACTTG AAAGCGGTGC CTATGACGCG CGCCAATTGC TCTTTGTCGG GTTCAGCGAT GGCGACGGCG
CGGCCGAGGG CAATACCCGC ATCGCGCTGA AGCGGGCCGA AGCGGTACGC GACGCGGTCT TGCAGACCGC CGAAACACTC
GACCCGGCCC GGGTGGAAGT CTCGGTCGAC GCATTTGGCG AGGCGCTGCC GATGGCCTGT GACGACAGCG ATTGGGGCCG
CCAGGTCAAC CGCCGGGTCG AGGTCTGGGT GAAATGA
>SPO0055 class=Sequence position=DSS3:54337..55893 (- strand)
ATGAATTGGC TTCGTGCGGC GGCTCTCGCC GCACTTTCCG TTTTCCCGGC GGTCCCGGCC GCCGCGCAGG ACATCACCCT
CACCTCGCAT GACGGCAAGG TCGAGATCAG CGGAAACTTG CTTGGTTTCG ACGGCGAATT CTATCGCGTC GAAACCCGCT
TCGGTGAACT GACGGTGGAC GGTTCCGGCG TCACCTGTGA CGGTCCGGCC TGTCCGAACC TGACCGACTT TGTCGCCGAA
CTGGCGCTGA GCGGATCCTC GACCATGGCC GAGGTGCTGC TGCCTGCATT GATCGAGGGG TTTGCCCTGC GCAACCGCAT
GCAGACCCGG CGCGAGACCG ATAGCGAGGC GCGCTTCAGC TATCTGCTGT TCCAGGCCGG CAGTGACAGA CCGCAGGCCC
GCTTCACCTT TCGCGTCAGC ACCACCGACG AGGGCTTTGC CGACCTGCTG GCGGACGAGG CCGATCTGGT GATGGCGCTG
CGTGAAATCC GCCCCGACGA ACGCCGGCGG GCGCTGGAAT TGGGTCTGGG CGACATGACC GACAGCAACC GCTCGCGGGT
GCTAGCGCTG GATGCGATGG TGCCGGTGGT GGCGCCCGTC AATCCGGTGC GCCAGGTCTC GGTCCCGCAG CTGGCACAGG
TCTTCGCCGG CGAGATCGAC AACTGGGCGC AGCTTGGCGG CCCGGACGCC CCCATCGCGC TGCATCTGCC CGCAGCGGGC
TCGGGGTTGG CGCAAGCGGT CGAAGACCGC CTGCTTCTGC CCGCCGGTAA ATCCCTGCCC GAAACGGTCG CCCGCCATGA
CCGCTCCAGC CTGTTGGCCC GCGCAGTTGC CATCGACCCG TTTGCCATCG GCATCGCCAG CTACTCCGAG ACAGGCACCG
CGCGGGCACT GACCCTGACC GGAGATTGCG GCTTTTCCCT TGCTGCCACC CGCCGCAATA TCAAGACCGA GGATTATCCG
CTCAACTCGC CCATGTTTCT TTACATGCCC GCGCGCCGCC TGCCCAAGCT GGCGCGCGAA TTCATGGCCT ATATGCGCAG
CCCGGCGGCA CAGATCGTGA TCCGCCGCGC CGGTTTCGTC GATCAGGCAC CCGAGTTGAT CCCGGTCGCC GTCCAGGGCA
ACCGGCTGGC CAATGCCATC GCCGCAGCCG GCACCGAGGT GCCGCTGACC GAGTTGCAAC GCCTCGTCTC GACCCTGTCC
GGCATGCAGC GGCTCAGCCT GTCTTTCCGG TTCGAGACCG GATCCTCGCG CCCCGATGCC CAGTCGCGCA CCAATATCTC
GCAACTGGCC CAGGAACTTG AAAGCGGTGC CTATGACGCG CGCCAATTGC TCTTTGTCGG GTTCAGCGAT GGCGACGGCG
CGGCCGAGGG CAATACCCGC ATCGCGCTGA AGCGGGCCGA AGCGGTACGC GACGCGGTCT TGCAGACCGC CGAAACACTC
GACCCGGCCC GGGTGGAAGT CTCGGTCGAC GCATTTGGCG AGGCGCTGCC GATGGCCTGT GACGACAGCG ATTGGGGCCG
CCAGGTCAAC CGCCGGGTCG AGGTCTGGGT GAAATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7