Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0056
Type: gene
Description:
Source: GenBank
Position: DSS3:55919..56911 (- strand)
Length: 993
Dbxref: GeneID:3193841
load_id: SPO0056
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:55919..56911 (- strand)
Length: 993
load_id: SPO0056.t01
parent_id: SPO0056
Parts:
Type: CDS
Description: NCBI:hypothetical protein; IMG:hypothetical protein
Source: GenBank
Position: DSS3:55919..56911 (- strand)
Length: 993
Dbxref: GI:564825957
  GeneID:3193841
Note: NCBI:hypothetical protein
  IMG:hypothetical protein
codon_start: 1
load_id: SPO0056.p01
parent_id: SPO0056.t01
product: hypothetical protein
protein_id: REF_tigr:SPO0056
  YP_165330.2
transl_table: 11
translation: MAQRRKILTAGGTVLCAALIGFLMQQNAARETQQVAARKSFIQQSVLKPSGASDVDDFAQ FELHAIKLTSAQPALEQPRRLPEPALEGALPLPARDILLPDAPSDPEEPQLGCAIIANAA PAPMASVALDVSAPCYGNQRVTVHHSGLIFTDTTDDAGTLSVTVPALSETAVFVVAFQNG RGAVAMSPVEGLDRIDRVVVQWSGAAGFQLHAREFGAGYGETGHVWSQSTDQGIGQVIRL GEPDTLEPQLAEIYSYPNGESDTAGTITLSIEAEVTATNCGRDISAQSLELRGAGSLTTH DLDMSMPDCSAAGDFLVLNNLVEDLKIAAR
Type: exon
Description:
Source: GenBank
Position: DSS3:55919..56911 (- strand)
Length: 993
parent_id: SPO0056.t01
> class=Sequence position=DSS3:55919..56911 (- strand)
ATGGCACAAC GACGCAAGAT ACTGACAGCT GGCGGAACCG TTCTCTGCGC GGCGCTGATC GGGTTTCTGA TGCAGCAGAA
CGCCGCGCGC GAGACGCAGC AGGTGGCGGC ACGCAAATCG TTCATCCAGC AATCGGTTCT GAAACCCTCG GGCGCATCCG
ATGTGGATGA CTTTGCCCAG TTCGAACTGC ACGCGATCAA GCTGACCTCG GCCCAGCCCG CTCTGGAACA GCCCCGCCGC
CTGCCCGAAC CGGCGCTCGA AGGCGCCCTG CCCCTGCCCG CGCGGGACAT CCTTCTGCCT GACGCGCCCA GCGACCCCGA
AGAGCCGCAA CTGGGTTGTG CGATTATCGC AAACGCCGCA CCTGCCCCCA TGGCCAGCGT CGCCCTTGAC GTCAGCGCGC
CCTGCTATGG CAACCAGCGT GTCACCGTGC ATCACAGCGG CCTGATCTTT ACCGATACGA CAGATGACGC GGGCACCCTG
TCGGTGACCG TCCCGGCCCT GTCCGAGACC GCCGTTTTTG TCGTGGCTTT CCAGAATGGC CGTGGTGCCG TCGCGATGAG
CCCTGTCGAG GGGCTCGACC GGATCGACCG GGTTGTCGTG CAATGGTCGG GCGCGGCGGG CTTTCAGCTG CACGCGCGCG
AATTCGGCGC CGGCTATGGC GAGACCGGCC ATGTCTGGTC CCAGTCCACT GACCAGGGTA TCGGACAGGT CATCCGTCTG
GGAGAGCCCG ACACGCTGGA ACCGCAACTG GCCGAGATCT ACAGCTATCC GAACGGCGAG AGCGATACCG CAGGTACCAT
CACCTTGTCG ATCGAGGCCG AGGTGACCGC CACCAATTGC GGCCGCGACA TCTCGGCACA GTCGCTGGAA CTGCGCGGCG
CCGGATCGCT GACAACCCAT GATCTGGACA TGTCCATGCC CGATTGTTCT GCTGCCGGTG ACTTTCTGGT GTTGAATAAT
CTGGTCGAAG ACCTGAAGAT CGCCGCCAGG TAA
>SPO0056 class=Sequence position=DSS3:55919..56911 (- strand)
ATGGCACAAC GACGCAAGAT ACTGACAGCT GGCGGAACCG TTCTCTGCGC GGCGCTGATC GGGTTTCTGA TGCAGCAGAA
CGCCGCGCGC GAGACGCAGC AGGTGGCGGC ACGCAAATCG TTCATCCAGC AATCGGTTCT GAAACCCTCG GGCGCATCCG
ATGTGGATGA CTTTGCCCAG TTCGAACTGC ACGCGATCAA GCTGACCTCG GCCCAGCCCG CTCTGGAACA GCCCCGCCGC
CTGCCCGAAC CGGCGCTCGA AGGCGCCCTG CCCCTGCCCG CGCGGGACAT CCTTCTGCCT GACGCGCCCA GCGACCCCGA
AGAGCCGCAA CTGGGTTGTG CGATTATCGC AAACGCCGCA CCTGCCCCCA TGGCCAGCGT CGCCCTTGAC GTCAGCGCGC
CCTGCTATGG CAACCAGCGT GTCACCGTGC ATCACAGCGG CCTGATCTTT ACCGATACGA CAGATGACGC GGGCACCCTG
TCGGTGACCG TCCCGGCCCT GTCCGAGACC GCCGTTTTTG TCGTGGCTTT CCAGAATGGC CGTGGTGCCG TCGCGATGAG
CCCTGTCGAG GGGCTCGACC GGATCGACCG GGTTGTCGTG CAATGGTCGG GCGCGGCGGG CTTTCAGCTG CACGCGCGCG
AATTCGGCGC CGGCTATGGC GAGACCGGCC ATGTCTGGTC CCAGTCCACT GACCAGGGTA TCGGACAGGT CATCCGTCTG
GGAGAGCCCG ACACGCTGGA ACCGCAACTG GCCGAGATCT ACAGCTATCC GAACGGCGAG AGCGATACCG CAGGTACCAT
CACCTTGTCG ATCGAGGCCG AGGTGACCGC CACCAATTGC GGCCGCGACA TCTCGGCACA GTCGCTGGAA CTGCGCGGCG
CCGGATCGCT GACAACCCAT GATCTGGACA TGTCCATGCC CGATTGTTCT GCTGCCGGTG ACTTTCTGGT GTTGAATAAT
CTGGTCGAAG ACCTGAAGAT CGCCGCCAGG TAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7